KEGG   Marinomonas posidonica: Mar181_1967Help
Entry
Mar181_1967       CDS       T01508                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mpc  Marinomonas posidonica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mar181_1967
  Amino acid metabolism
   00340 Histidine metabolism
    Mar181_1967
Enzymes [BR:mpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mar181_1967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2141214..2142524)
Genome map
AA seq 436 aa AA seqDB search
MKLNIREFSSSSVDFRSELDALLAWDSVSDAGVQQAVTDIVTQVRQRGDEAVVEFTNRFD
RRDVTSSSELEISREQLVEAKLRVSEELVGSLEAAAQRVHEYHERQKQPSWQYQEVNGTV
LGQKVTPLDRVGVYVPGGKAAYPSSVLMNVMPAKVAGVGEIIMVVPTPDGFVNDIVLAAA
YIAGVDRVFTVGGAQAVAALAYGTETIPKVDKIVGPGNIYVATAKRMVFGAVGIDMIAGP
SEILVVCDGKTDPDWIAMDLFSQAEHDEDAQSILISPDASYIQKVKQSMEALIESQSRKD
IIKVSLEGRGALIHVADMDEAMDIANLVAAEHLELSVDEPEKWAEKIRHAGAIFMGRHTP
EALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLINCSPKGASELAKIASPLARGES
LEAHAMSAEYRILKED
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgaatatacgagagttttcttcaagctctgtggactttcgtagtgagcttgac
gctttgttggcctgggactctgtttccgatgctggtgttcagcaggccgttactgacatt
gttacgcaagtacgacaacgtggcgatgaggcggttgttgagtttactaatcgctttgat
cgccgtgatgtgacttcttcaagtgaattggaaatttcacgagagcagttagtagaagcg
aaattgcgcgtcagtgaagagctagtcggcagtttagaagccgcagcgcagcgtgtacat
gaatatcatgagcggcaaaaacaaccctcttggcagtatcaagaggttaatggtaccgtt
ttaggtcagaaagtgacgccattagatcgagtgggggtttatgtccctggcggtaaagcg
gcatacccatcttctgtattaatgaatgtcatgccagcaaaagtggcaggtgttggcgag
atcattatggtggtgccgactcctgatggatttgtgaatgatattgttttggcggctgcc
tacattgctggcgtagatcgtgtcttcactgttggcggtgcgcaagctgtagcagccttg
gcatacggtacagaaaccattccgaaagtcgataaaattgttggtcctggtaacatttat
gtggccacggctaagcgcatggtgtttggtgctgttggcattgatatgattgctggtccc
tctgagatcctggtggtatgtgatggcaaaaccgatcctgattggattgcaatggatcta
ttctcgcaggcagagcatgatgaagatgcacaatcgattttgatctctcctgatgcaagc
tatatccagaaggtcaaacaatccatggaggctttgattgagtctcaaagccgaaaagac
atcattaaagtgtctttggaagggcgtggcgcattaattcacgtggcggatatggatgaa
gctatggacattgccaatcttgtggccgcagagcacttagagttgtctgtcgatgagcca
gaaaaatgggctgagaaaattcgtcacgcaggtgctattttcatggggcgtcatacaccg
gaagcattaggagattattgtgcgggtcctaatcacgtgctacccacgtcgggaactgct
cgcttctcatcacctttaggtgtgtatgatttccaaaaacgtagctctttaattaattgc
tctcctaaaggtgcaagtgagttggcaaaaattgcatcccctttggctcgtggtgagtca
ttagaggcgcacgctatgtcggctgaatatcgtatcctaaaggaagactga

DBGET integrated database retrieval system