KEGG   Marinomonas posidonica: Mar181_1969Help
Entry
Mar181_1969       CDS       T01508                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00520  Amino sugar and nucleotide sugar metabolism
mpc00550  Peptidoglycan biosynthesis
mpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mar181_1969
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mar181_1969
Enzymes [BR:mpc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Mar181_1969
Peptidoglycan biosynthesis and degradation proteins [BR:mpc01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Mar181_1969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AEF55007
JGI: Mar181_1969
UniProt: F6CSF3
Position
complement(2143171..2144433)
Genome map
AA seq 420 aa AA seqDB search
MDKLLITGGSPLNGVVRASGAKNAALPILAATLLTKDLITIKNLPHLHDITTMLELLGSM
GCGVVVDEKMSVQLDISTLNNCEAPYELVKTMRASILVLGPLVSHFGRAVVSLPGGCAIG
SRPVDLHLRGLEAMGAKIDVTGGNIVATVDGRLQGARIFFDKVTVTGTENLLMAATLAEG
QTVLENAAREPEVVDLAECLIAMGAKITGHGTDTIVIEGVEALNGTTYPVMPDRIETGTF
LVAAAITGGKVKVIDTDVKSLEAVLAKLEEAGAKVACGENWIEVDMEGRRPNAVNISTAP
YPAFPTDMQAQFVALNSVATGVGRVIENIFENRFMHVDEMLRMGADIEVMGNTAIIRGCD
KLKGAPVMATDLRASASLVLSALVAEGDTKIDRIYHIDRGYECIEEKFGALGAKISRVLN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggataagcttctaattacgggtggatcgcccctaaatggtgttgtacgagcttcaggt
gctaaaaatgcggccttacctatcttggcggcaaccttgttaaccaaggatttaattact
attaaaaatttacctcatttacatgacattaccaccatgttggaacttttaggttctatg
gggtgtggtgtggttgtggatgagaaaatgagtgtgcaacttgatatttcgacactcaat
aattgtgaagcaccttatgaattggttaagaccatgcgtgcttctatcttggttttgggg
ccattagttagtcattttggccgcgctgttgtgtccttgcctggtggttgtgctattggt
agtcgtcctgttgatctgcacttacgtggtttagaggcaatgggggcaaaaattgatgtg
acaggcggtaacatcgtcgctacggtcgatgggcgtttgcagggtgctcgaattttcttt
gataaagtcacggtaacaggtaccgagaacttgttaatggccgctaccttagcggaaggt
caaactgtcttggaaaatgctgcccgtgagccagaagtggttgatttggcggaatgttta
atcgccatgggagcaaaaatcaccggtcatggtacggatactattgtgattgagggtgtt
gaagcgctaaatggcacgacttaccctgttatgccagatcgcattgagactggcaccttc
ctagtggcggctgcgattactggcggcaaagtgaaagtgattgataccgatgttaaatca
ttagaggcggttttggccaagctggaagaagcaggtgcaaaagtcgcttgtggtgaaaac
tggattgaagtcgatatggaagggcgccgaccaaatgcagtcaatattagtacggcacct
tatcctgctttcccaacggatatgcaagcacagtttgttgcgcttaactctgttgcaacc
ggtgttggccgagtcattgagaacatctttgaaaatcgtttcatgcacgtagatgaaatg
ttgcgtatgggtgctgatattgaggtaatgggtaataccgctattattcgtggttgcgat
aaactaaaaggcgcaccagtcatggcgaccgatcttcgtgcttcagctagtttggtattg
tctgctttggtggcggaaggtgatacgaaaatagatcgtatttatcacattgaccgtggc
tatgaatgtatcgaagaaaaattcggtgctttgggtgcaaaaatttcacgagttttaaat
taa

DBGET integrated database retrieval system