KEGG   Marinomonas posidonica: Mar181_2055Help
Entry
Mar181_2055       CDS       T01508                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mpc  Marinomonas posidonica
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mar181_2055
Enzymes [BR:mpc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Mar181_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2244118..2245875
Genome map
AA seq 585 aa AA seqDB search
MEHAPLSQLEQRLMAHLQLLYPTLDHKELARKCLSTFFLDPATESPRPHRNLWDQSDVML
ITYADTLRKKGEAPLETLHNFVKSKLACCISAVHLLPFFPYSSDDGFSVMDYTTVNPSSG
NWDHVSSLSEDFKVMGDLVINHCSSRSMWFENYKAGVEPGATFFYEADPNADLSAVVRPR
TSPLLREVKTQTGEKYVWCTFSHDQVDLNFENPDVLIEFLRIIRLYLEKGIRWFRLDAVA
FLWKIPGTTCINLPQTHEMIRLLRLMIEHYAPEAVIITETNIPNQENLTYFGNANEAHLI
YNFSLPPLLINSLVTGNCNHLKQWLMSMPPAQQGTTYLNFIASHDGIGLRPTEGLLSEWE
LETLINTMKRFGGKLSSRTTPKGEAKPYEINISLWDALSGSAHQGPDQWQFARFLCAAGV
MMALEGVPAFYIHSLFGTENDFERVDNTGHFRSINRHIWDMDELDHALNTPTHHQKVFNS
VTNLLKVRRAQPAFHPNATQYILHMGENLFAFWRQSLDRRQSLFAVYNMTDQPQHFNLSE
LNLIATDIWTDLVSEQVYEDHLGKVTLMPYQFVWLANKKGKIKDD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgctcccttgtcacaattagagcaaaggctaatggcgcatttgcaacttctc
tatccaacacttgaccacaaagagttggcgagaaaatgtttatcgaccttctttcttgat
ccagcgacagagtcacctcgacctcatagaaatttatgggatcagtccgacgtcatgctg
atcacttacgcagacaccctgcgtaaaaaaggcgaagcaccattagaaaccttgcataat
tttgtcaaaagcaaactggcctgctgcatctctgccgttcaccttttgccttttttcccc
tacagttcagacgacggtttcagtgtgatggattacaccaccgtcaatccttcatccggt
aactgggatcatgtttccagcttatcagaggatttcaaagtcatgggggacctggtcatc
aatcattgttcaagccgaagcatgtggtttgaaaactataaagctggcgttgaacctggc
gcgacatttttctatgaagcggacccaaatgccgatttaagtgccgttgtcagacctaga
acgtcccctctgttacgtgaagtcaaaacccaaaccggagaaaaatacgtttggtgtacc
tttagtcacgatcaggtggatttgaattttgagaatccagatgtcttgatcgaattcctt
cgcatcattcgtctttatttagagaaaggcattcgctggttccgactggatgccgtagca
ttcctttggaaaatcccagggacaacttgcattaacctgcctcaaacccatgagatgatc
cgtctattgcgtttgatgatagaacattacgcgcctgaagccgtgatcatcaccgaaacc
aatattccaaatcaggaaaacctaacctactttggtaatgccaacgaagcccatttaatt
tacaacttctccttgcctcccttgctgatcaatagcctagtaaccggcaactgcaaccac
ttaaaacaatggttgatgagcatgccacccgcccagcagggtacgacttacctgaatttc
atcgcttcgcacgatggcataggtttgcgtccaacagagggtttgttgtcagaatgggaa
ctggaaacgctcattaacaccatgaagcgttttggtggcaagctcagctcacgcaccaca
ccaaaaggtgaagccaaaccatacgaaatcaacatcagtttatgggatgccttgtcaggt
tccgctcaccaagggccagaccaatggcagtttgctcgtttcctttgtgccgctggtgtg
atgatggcgttggaaggcgttcccgcgttttatattcacagtctattcgggacagaaaat
gactttgaacgggtcgataatacggggcacttccgatcaatcaatcgccatatttgggac
atggatgaattagatcacgcgctgaatacaccgacgcaccatcaaaaagtctttaacagc
gtcaccaacttgttaaaagttcgtcgcgctcaaccggcttttcaccccaatgctacccaa
tacatattgcacatgggggaaaacctctttgccttttggcgccaaagcctagacaggaga
caaagcctctttgcggtatacaacatgacagatcagccacaacattttaatttgtcagag
ctaaatctaatcgcaacggacatttggaccgatcttgtttcggaacaggtatatgaagat
catctgggcaaagtcaccctaatgccttaccaatttgtttggttggccaataagaaaggc
aaaatcaaagacgactaa

DBGET integrated database retrieval system