KEGG   Marinomonas posidonica: Mar181_2144Help
Entry
Mar181_2144       CDS       T01508                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mpc  Marinomonas posidonica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mar181_2144
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mar181_2144
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mar181_2144
Enzymes [BR:mpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mar181_2144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2342992..2343777
Genome map
AA seq 261 aa AA seqDB search
MSQLAEFTQQKLINKPILAMTHVVYGYPSITESLSWMRRLLEEGVDFIEVQFPFSDPVAD
GPSIVAACHKALEQTLDVDTCLSQLGELSRDFPESRIVLMSYLNPMYRFGLEKLAKRASE
EKILGLILPDLPIESAKQYQQACHQYHIDPVWLVTPVTPADRLAMLASQASGFLYCVARS
GVTGNSSHEDKAKEASLDDYLAQIKQHASAPIGVGFGLRKRAQIEQLIGKADIAILGSAL
LDAYNQGGQKAGIELINELFH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattagccgaattcacccagcaaaaactcatcaacaaacccattttagccatg
actcatgtggtgtatggctacccaagcattacagaaagcctgtcttggatgagaagatta
ttagaggaaggcgttgattttattgaagttcaatttcctttttcagatccggttgcggac
ggtccaagtattgtcgcagcgtgccacaaagcacttgaacaaacattggacgttgacacc
tgtttatcacaactgggggaactgtcgcgggattttccagaaagccgtattgtcctcatg
agctacctaaatcctatgtatcgtttcggcttagaaaaactcgccaaacgcgcctcagaa
gagaagattctaggtctcattttaccagacttaccaattgagtcggccaagcaatatcaa
caagcctgtcatcaatatcatattgatccggtttggttagtgacgcctgtaacaccagca
gatcgacttgccatgctggctagtcaagccagtggcttcttatattgtgtcgcaagatca
ggggtaacgggcaattcaagccatgaagacaaggccaaagaggcctctttagacgattat
ttagctcaaataaaacaacatgccagtgcaccaattggggttggttttggcttacgcaaa
cgcgcccagatagagcaactcataggtaaggcggacattgccatcttaggttcagcgctt
ctcgatgcctacaaccaaggtggtcaaaaggctggcatcgaattgatcaatgaactgttt
cattaa

DBGET integrated database retrieval system