KEGG   Marinomonas posidonica: Mar181_2246Help
Entry
Mar181_2246       CDS       T01508                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mpc  Marinomonas posidonica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mar181_2246
Enzymes [BR:mpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mar181_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2472236..2473129)
Genome map
AA seq 297 aa AA seqDB search
MTIYNVGSINLDHLYQLDHFVRPGETMASDHYQCLLGGKGANQSVALAKAGAEVKHVGAI
HHTDQSVVTQLQSLGVDTSLIRQIDVPTGHAIIQLTKEAENSIILYQGANHALTEEQVDQ
VLENAQQGDWVLLQNETNLIEYVMKKAQQQGVKVAFNPAPMNIALTKKLLGLVDLLIVNE
VEAMDLIGTPDIDSTLAAFPKAYPDLAVLMTLGKAGVCYFNGEERLQVAAFSVNAVDTTA
AGDTFIGFCLSAMMQGQGMAESIRRACAASAICVTRLGAASSIPTQQEVTAFLAQHD
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttataatgttggttcgattaatctcgaccacctctatcagttagaccatttc
gttcgacctggtgaaaccatggcttcagaccattaccagtgtttgctcggggggaagggc
gcgaatcagtccgttgccttggcaaaagcgggtgctgaggtaaaacacgtaggggcgatt
caccataccgatcaaagtgtggtgacacagttgcagtctttgggggtcgacaccagtttg
atccgacaaattgatgtgccgacggggcacgcgattattcagctgacgaaagaagcagaa
aattcgattattctttaccaaggtgcgaaccatgctttaacagaagagcaggtggatcag
gtgttggagaatgctcagcagggtgattgggtgttgttgcaaaatgagaccaatctcatt
gaatatgtgatgaagaaagcgcagcagcagggagtgaaagtcgcctttaatccagcgcca
atgaacattgctctgaccaaaaaattgcttggcctagtagatttactgatcgttaatgaa
gttgaggcgatggacttaattggcacacctgacatcgacagtacccttgctgcttttccg
aaagcttaccctgatttggcggtactgatgacattaggcaaggcgggtgtatgttatttc
aatggtgaagaacgcctccaagttgcggcattttccgtgaatgccgttgataccacggcg
gctggcgatacctttattggtttttgtttgtcggccatgatgcaaggccaaggcatggct
gagtccatccgacgtgcttgtgctgcttcggcaatatgcgttacccgtttaggagcggct
tcatccataccaactcagcaggaagtcacagcatttcttgctcagcatgactag

DBGET integrated database retrieval system