KEGG   Marinomonas posidonica: Mar181_2331Help
Entry
Mar181_2331       CDS       T01508                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mpc  Marinomonas posidonica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mar181_2331
Enzymes [BR:mpc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mar181_2331
Exosome [BR:mpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mar181_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2559575..2561767
Genome map
AA seq 730 aa AA seqDB search
MDLVKHDLFQDLAKTQCADPFGCLGCHPDPVTQEPTLYVWQPEAESIVVLGLDHDQILMC
LTPSELNGLFVAPWPDDISSQHYRLKVQYRDGNHHTLVDPYQFADSSFKDPEHHTANLFK
SQGAIHRSAYIHDKLSIQGTRFAVYAPAARSVSVVGDFNGWDGRVHPMSSNGDGIWRLFI
PDVNHGARYKFEIRAHDGQLLPHRTDPYAQQIEQFPSFASITCFDRHHVWSDSDWCQRSV
ENLYERPMSIYEVHLGSWRRKQGNQALSYLELKDQLVPYVKSMGYTHVELLPITEYPFDG
SWGYQPVGLYAVTSRFGHPEDFKALVDAFHQAGIGVIMDWVPAHFPADSHGLANFDGSKQ
YEYPDPKKGWHPEWNSLIYDFGKDHVVNYLISNAVYWLEEFHIDGLRVDAVASMLYLDYA
REEGEWIPNQDGGNHNYEAIAFLRKLNETIYLNHPRCFTVAEESTAFPGVSKPTFMNGLG
FGFKWNMGWMNDTLDYMQRDAIYRQYHQGDLSFSMVYAFDEQFVLPISHDEVVHGKCSMI
DKMPGDAWQKFANLRAFSAYMYCHPGKKLNFMGNEFAQGQEWSHERSLDWHLLDIAYHKA
QQDLTKDLNQLYQQQTSLHCDHSADGFEWISHDDSQNSILAFVRRTKGSSQHLLVIINFT
PTPHTHYRIGVPETGQYQVLLNTDDANYQGSQFTQQSTYSTDPIAHHGRANSIEVQVPPL
SGLIFTWRQD
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggatttagtcaagcacgacctgtttcaagatttagcgaaaacacaatgtgccgaccct
tttgggtgtttaggatgccacccagacccagtaactcaagaaccaaccttatacgtttgg
caacccgaggcagagtccattgtggttcttggccttgatcacgatcaaatactaatgtgc
ctgacgccctcggaactaaatgggttatttgtggccccttggccagatgacataagcagt
caacattatcgattaaaagtccaatatcgagatggcaatcatcatactttggtcgatccg
taccagtttgctgacagcagtttcaaagaccctgaacaccacacggctaacctctttaaa
agccaaggggctatccatcgaagcgcgtatattcatgataagttaagcattcaaggcact
cgctttgctgtctatgcgccagccgcacgttccgtgtctgtggtaggagactttaacggt
tgggatggtcgtgttcatccaatgtcgagtaatggcgatggcatctggcgcttatttata
cccgacgtcaatcatggtgctcgttataaatttgaaattcgtgctcatgatggtcaattg
ctcccccatcgaaccgatccttatgcacaacaaattgaacaatttccatcatttgccagc
atcacatgttttgaccgccatcatgtttggagcgactccgactggtgccaacgctcggtt
gaaaatctttacgaacgccctatgagcatttatgaagtacacctaggttcatggcgacgc
aaacaaggtaatcaagctctcagctatttagaactcaaagaccagctggtgccttatgtc
aaaagtatggggtacacccatgtagagttattgcccatcaccgagtacccttttgatggc
tcttggggttatcaacccgttggtctgtatgccgtgacatctcgcttcggtcatcctgaa
gactttaaagccttggtcgacgcgtttcaccaagcaggcattggcgtgattatggattgg
gtgccagcgcattttccagctgacagccacggcttggcaaattttgacggttccaaacaa
tacgaatacccagaccctaaaaaaggttggcacccagaatggaactccttaatctatgat
ttcggtaaggatcatgtggtcaattacctaatcagcaatgcggtttattggttggaagag
tttcatattgatggcttgcgagtcgatgccgtcgcttccatgctataccttgattatgcc
cgtgaagagggtgaatggattccaaatcaagatggtggtaatcacaactatgaagccatc
gcgtttctgcgaaaattgaatgaaaccatttaccttaatcaccccagatgttttaccgtg
gccgaggaatccaccgcgtttcctggcgtgtctaagccaacctttatgaatggtctaggc
tttgggtttaagtggaacatgggctggatgaatgacaccttagattacatgcaacgtgac
gccatttaccgtcaatatcatcaaggcgatttgagcttcagcatggtttacgcttttgat
gagcaatttgttctgcccatttcccacgacgaagtggtccatggaaaatgctcgatgatc
gacaagatgcctggcgatgcttggcaaaagttcgcaaacttacgtgccttttcggcttac
atgtactgccatccaggtaaaaagctgaacttcatgggaaatgagttcgcacagggacaa
gaatggagccacgaacgttcgctcgactggcatttgctcgacattgcttatcataaggcg
caacaagatctcaccaaagacttaaaccagctctatcagcagcaaaccagtttgcactgt
gatcattctgccgacggctttgaatggatcagccacgatgatagtcagaacagtattctc
gcctttgtacgccgtactaagggctcctcgcaacaccttttggttatcatcaatttcacc
cccacccctcatacccactatcgcataggtgtacccgaaaccgggcaatatcaggtactg
ctgaataccgacgacgccaattatcaaggcagtcaatttacccaacagtcgacttattca
accgaccctatagcgcatcatggccgtgcgaatagcatcgaggtacaggttccccctctg
agtggattaatcttcacttggcgacaggattga

DBGET integrated database retrieval system