KEGG   Marinomonas posidonica: Mar181_2624Help
Entry
Mar181_2624       CDS       T01508                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00900  Terpenoid backbone biosynthesis
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mar181_2624
Enzymes [BR:mpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Mar181_2624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEF55655
JGI: Mar181_2624
UniProt: F6CY23
Position
complement(2908622..2909794)
Genome map
AA seq 390 aa AA seqDB search
MQGICLLGATGSIGQSTLDIIAQHPDKFSLVSASANTSVAKMVDICRQFQPQRVVMGSQS
ARDELALLCADLDISFEWGESSLESIAADSAVDQVMAAIMGFAGLKPTLSGIRAGKRILL
ANKESLVTAGKLFMDEVANHNVCLLPIDSEHNAIYQSLPQHSAGAHKQDVDKIILTASGG
PFRTWSLDEMANVTPEQACKHPNWSMGQKISIDSASLMNKGLELIEACWLFDVTPDEVDV
VVHPESIIHSMVSYRDGSVISQMGNPDMKIPIAYGMTWPNRIETNVPPLNLTEIARLNFE
SPDLRRFPNLQLAADAWYLGGTAMATLNAANEIAVASFLQGRIGFLDIARVNHKVLHQAE
VIPVNDLDVVFAADVCARKLAEACIVQETF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtatttgtctgttaggcgcaacgggctcgattgggcaaagtacgctggacatt
atcgctcagcatccagataagttttcccttgtcagtgcttccgccaataccagtgtggcc
aaaatggtggatatttgtcgtcagtttcagccacagcgagtagtgatgggctctcaatct
gctcgagacgagttggcgttgttgtgtgctgatctcgatatttcctttgaatggggtgaa
tcgtctttagaaagtattgctgcagacagtgctgtcgatcaagtgatggccgcgatcatg
gggtttgctggtttaaagccgaccttgtcagggattcgtgcaggtaagcgtattctacta
gcaaataaagagtccttagtcacagcgggcaagttgtttatggatgaggtggcaaatcac
aatgtgtgtttgctgccgattgacagtgaacacaatgctatttatcaaagcttgcctcag
cattcagctggagcgcataagcaagatgtagataaaattattttgaccgcatctggtggc
ccattccgcacttggtcattagatgagatggcgaatgtcacaccggagcaagcttgtaag
catcctaattggtcgatggggcaaaaaatttccattgattctgcgtccttgatgaacaaa
ggattggaattaatcgaagcttgttggctatttgatgttacgcctgatgaagttgatgtg
gtggttcaccctgaaagtatcattcattcaatggtgtcgtatcgagacgggtcggtcatt
tctcagatgggcaatccggacatgaaaattcccatcgcttatggcatgacttggcccaat
cgaattgaaaccaatgtaccgcctttaaatcttaccgaaattgctaggttaaattttgag
tctccagacttacggcgattccccaatttacagctagcggcggatgcttggtatttgggg
gggacggcgatggcgaccctaaatgcggcgaatgaaatagcggttgcatcctttttgcag
ggacgaattggtttcctagacattgcgcgtgtaaatcataaagtcttgcaccaagctgag
gtgatcccagtgaatgatcttgacgtggtgtttgctgcggatgtttgtgcccgcaagctg
gccgaagcctgtattgttcaggagacattttaa

DBGET integrated database retrieval system