KEGG   Marinomonas posidonica: Mar181_2678Help
Entry
Mar181_2678       CDS       T01508                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mpc  Marinomonas posidonica
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mar181_2678
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mar181_2678
Enzymes [BR:mpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mar181_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2964595..2966199)
Genome map
AA seq 534 aa AA seqDB search
MQTYKNKMQQASQLIGQQGTTWAGMNPEYVARMQLQNRFNTGLDIAKYTAKIMREDMASY
DQDQANYTQSLGCWHGFIGQQKMISIKKHFGTTRSRYLYLSGWMVAAMRSEFGPLPDQSM
HEKTSVPALIEELYTFLKQADAREMQHLFKELDEARQAGDQVREQAAQESIDQFETHVVP
IIADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKI
NAVRYAFLELGVEDGVIVARTDSLGAGLTQKIPVSQSAGDLAEQYSAFIDGEEVTSLDQM
QSGDMLLKQGGTCIKPTRLANGLVRFKPDTGADRVVLDCITSLQHGADLLWIETEKPHIG
QIANLVNRIREVVPNAKLVYNNSPSFNWTLNFRQQVFDAWQEAGKDVNEYDRDRLMSKEY
DATTLAIEADERIRNFQRDAAAQAGIFHHLITLPTYHTAALSTDNLAKDYFGDQGMLGYV
KEVQRKEIREGLACVKHQDMSGSNIGDDHKEYFSGDNALKASGKDNTMNQFAAV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgtataaaaataaaatgcaacaagcgagtcagctaatcggtcaacaaggcacg
acttgggcgggtatgaatccagaatacgtggctcgtatgcaattacaaaaccgttttaat
acgggtttggatattgccaaatacacagccaaaatcatgcgtgaagatatggcaagttat
gatcaagaccaagcaaactacactcaatctttgggttgctggcatggttttatcggccaa
caaaaaatgatttctattaagaaacattttggcactactcgcagtcgctacttgtacctt
tctggttggatggtggctgccatgcgctctgagtttggtcctctaccagatcagtctatg
catgaaaaaacttcggtaccagccttaatcgaagagctgtataccttcttaaaacaagct
gatgcccgagagatgcaacatttgtttaaagagcttgatgaagcccgtcaagcgggtgac
caagtgcgtgagcaagcagcacaagaaagtattgatcagtttgaaacgcatgtggtgccg
attatcgctgatattgatgcgggttttggcaatgaagaagccacgtatttgttagcaaag
aaaatgattgaagcaggggcttgctgtattcaaattgaaaaccaagtatctgatgcgaaa
caatgtggtcaccaagacggtaaagtgacagtgcctcatgaagactttttagcgaaaatt
aatgctgttcgctatgccttcttggaacttggtgtggaggatggggtgatcgttgcacgt
accgattcattgggtgcaggtttaacccaaaaaattcctgtatcacaatctgcgggcgat
ttggctgagcaatacagtgccttcattgatggtgaagaggtcacatctcttgatcagatg
cagtctggtgacatgttgctgaagcaaggtggaacatgcattaaaccaactcgtttggcg
aatggtttggtgcgctttaagcctgatacgggagcggatcgagtagtgctggactgcatt
acgtcgttacaacatggtgcagatctgttgtggattgagacagaaaaacctcatattggt
caaattgctaatttggttaatcgtatccgcgaagtggtgccaaatgcgaaactggtttac
aacaacagtccttcgtttaactggacgttaaatttccgtcagcaagtgtttgatgcttgg
caggaagcgggcaaagacgtgaatgaatatgatcgtgatcgtctaatgtcaaaagaatac
gatgcgaccacactagcgatagaggcggacgaacgcattcgtaacttccagcgcgatgca
gcggctcaagcagggattttccaccacttgattaccttgcctacctaccatactgctgcg
ttgtcgacggataatttggcgaaagattactttggtgatcagggcatgttgggttatgta
aaagaagtacaacgtaaagagattcgtgaaggtcttgcctgtgttaagcaccaagacatg
tctggttccaatattggtgatgatcataaagagtatttctctggtgacaatgcactaaaa
gcatctggtaaagacaatacgatgaatcaattcgcggcggtttaa

DBGET integrated database retrieval system