KEGG   Marinomonas posidonica: Mar181_2678Help
Entry
Mar181_2678       CDS       T01508                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00630  Glyoxylate and dicarboxylate metabolism
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01120  Microbial metabolism in diverse environments
mpc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mar181_2678
Enzymes [BR:mpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mar181_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEF55709
JGI: Mar181_2678
UniProt: F6CYM7
Position
complement(2964595..2966199)
Genome map
AA seq 534 aa AA seqDB search
MQTYKNKMQQASQLIGQQGTTWAGMNPEYVARMQLQNRFNTGLDIAKYTAKIMREDMASY
DQDQANYTQSLGCWHGFIGQQKMISIKKHFGTTRSRYLYLSGWMVAAMRSEFGPLPDQSM
HEKTSVPALIEELYTFLKQADAREMQHLFKELDEARQAGDQVREQAAQESIDQFETHVVP
IIADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKI
NAVRYAFLELGVEDGVIVARTDSLGAGLTQKIPVSQSAGDLAEQYSAFIDGEEVTSLDQM
QSGDMLLKQGGTCIKPTRLANGLVRFKPDTGADRVVLDCITSLQHGADLLWIETEKPHIG
QIANLVNRIREVVPNAKLVYNNSPSFNWTLNFRQQVFDAWQEAGKDVNEYDRDRLMSKEY
DATTLAIEADERIRNFQRDAAAQAGIFHHLITLPTYHTAALSTDNLAKDYFGDQGMLGYV
KEVQRKEIREGLACVKHQDMSGSNIGDDHKEYFSGDNALKASGKDNTMNQFAAV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgtataaaaataaaatgcaacaagcgagtcagctaatcggtcaacaaggcacg
acttgggcgggtatgaatccagaatacgtggctcgtatgcaattacaaaaccgttttaat
acgggtttggatattgccaaatacacagccaaaatcatgcgtgaagatatggcaagttat
gatcaagaccaagcaaactacactcaatctttgggttgctggcatggttttatcggccaa
caaaaaatgatttctattaagaaacattttggcactactcgcagtcgctacttgtacctt
tctggttggatggtggctgccatgcgctctgagtttggtcctctaccagatcagtctatg
catgaaaaaacttcggtaccagccttaatcgaagagctgtataccttcttaaaacaagct
gatgcccgagagatgcaacatttgtttaaagagcttgatgaagcccgtcaagcgggtgac
caagtgcgtgagcaagcagcacaagaaagtattgatcagtttgaaacgcatgtggtgccg
attatcgctgatattgatgcgggttttggcaatgaagaagccacgtatttgttagcaaag
aaaatgattgaagcaggggcttgctgtattcaaattgaaaaccaagtatctgatgcgaaa
caatgtggtcaccaagacggtaaagtgacagtgcctcatgaagactttttagcgaaaatt
aatgctgttcgctatgccttcttggaacttggtgtggaggatggggtgatcgttgcacgt
accgattcattgggtgcaggtttaacccaaaaaattcctgtatcacaatctgcgggcgat
ttggctgagcaatacagtgccttcattgatggtgaagaggtcacatctcttgatcagatg
cagtctggtgacatgttgctgaagcaaggtggaacatgcattaaaccaactcgtttggcg
aatggtttggtgcgctttaagcctgatacgggagcggatcgagtagtgctggactgcatt
acgtcgttacaacatggtgcagatctgttgtggattgagacagaaaaacctcatattggt
caaattgctaatttggttaatcgtatccgcgaagtggtgccaaatgcgaaactggtttac
aacaacagtccttcgtttaactggacgttaaatttccgtcagcaagtgtttgatgcttgg
caggaagcgggcaaagacgtgaatgaatatgatcgtgatcgtctaatgtcaaaagaatac
gatgcgaccacactagcgatagaggcggacgaacgcattcgtaacttccagcgcgatgca
gcggctcaagcagggattttccaccacttgattaccttgcctacctaccatactgctgcg
ttgtcgacggataatttggcgaaagattactttggtgatcagggcatgttgggttatgta
aaagaagtacaacgtaaagagattcgtgaaggtcttgcctgtgttaagcaccaagacatg
tctggttccaatattggtgatgatcataaagagtatttctctggtgacaatgcactaaaa
gcatctggtaaagacaatacgatgaatcaattcgcggcggtttaa

DBGET integrated database retrieval system