KEGG   Marinomonas posidonica: Mar181_2786Help
Entry
Mar181_2786       CDS       T01508                                 

Definition
flagellar protein FlaG protein
Orthology
K06603  
flagellar protein FlaG
Organism
mpc  Marinomonas posidonica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3086279..3086698)
Genome map
AA seq 139 aa AA seqDB search
MSINSSDFSKQSVGVVATRQDQRMGEQFRSQQDAGAKTVQNLSDSNKANNQNKQGFTGTT
KIDREAVESANRKMSQLNVQLSFEMTEDRSKNIVKVLDQATGDVVRQMPTEEFLKMSERI
DAIMNQLSDVKGTLVNSEV
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaattctagtgatttttctaagcagtctgtaggggttgttgcgactagacaa
gatcaacgtatgggcgagcaatttagatcgcagcaggacgcaggtgctaaaaccgttcaa
aatttgtccgatagtaataaagccaataatcaaaataaacaaggatttactggaactaca
aagatagatagagaggccgttgagagtgcgaatcgcaaaatgtctcaattaaatgttcaa
ctatcatttgaaatgaccgaagatcgtagtaaaaatattgttaaggtattggatcaagca
accggtgatgtagttcgacaaatgccgacggaagagtttctaaagatgtcggaacgaatt
gatgctattatgaatcaattaagtgatgttaaagggacattggttaatagtgaagtttga

DBGET integrated database retrieval system