KEGG   Marinomonas posidonica: Mar181_2834Help
Entry
Mar181_2834       CDS       T01508                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mpc  Marinomonas posidonica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mar181_2834
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mar181_2834
   00052 Galactose metabolism
    Mar181_2834
   00500 Starch and sucrose metabolism
    Mar181_2834
   00520 Amino sugar and nucleotide sugar metabolism
    Mar181_2834
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mar181_2834
   00524 Butirosin and neomycin biosynthesis
    Mar181_2834
Enzymes [BR:mpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mar181_2834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3138424..3139398)
Genome map
AA seq 324 aa AA seqDB search
MSHALIADLGGTNARFALVPIHQFEPLEVKVLPCKNYETFFDAAADYVDHCSVDLKDIDA
VVLAIAGPVNQDVIRFTNNPWHFTREEVQNYFGVDKQVALLNDFDAIGHCLEVLPETDKV
VLGDVSQVDPTAASWVIGAGTGLGVACIVPQDNGPNIVLPGEGGHVDLSTCNEVEDDIIV
FLRKRHKRVSAERVLSGMGLENIYEALAARHGIEKRLSAPEIGEALKAGNDPIAKATLEQ
FFVFLGRVIGNLVLSVEARGGVYIAGGIVPRYLKEILCSGFREAMQDKGRMKEFVSPIPT
FVVMSEYPGLMGCACYASYLVSKA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatgctttaattgccgaccttggtggcacaaacgcacgatttgctttggtgcca
atacaccaatttgagccacttgaagtcaaagtacttccttgtaaaaactatgagactttt
tttgatgcggcggcggattatgttgatcactgtagtgttgatttaaaagacatagacgct
gtggtgttggccattgccggaccagtgaatcaagatgtcatacgctttacgaataaccct
tggcattttacacgtgaagaagtacagaattactttggtgtggataagcaagtcgcctta
ttaaatgattttgatgcgataggccattgtctcgaagtgttgccggaaaccgataaagtg
gtgttgggagacgtgagtcaagtcgatccaaccgctgcaagctgggtaattggtgctgga
acagggttaggggtggcttgtattgtccctcaggataatggacccaatatcgtgttacct
ggagaaggtggtcatgtagatctatcgacttgcaatgaagtcgaagacgatattatcgtt
ttcttgcgtaaacgtcataaacgagtatcagcagagcgagtgctgtctggtatgggctta
gaaaatatttatgaagccttagccgctcgacacggtattgagaagcgtctgtcagcgcct
gaaattggtgaggcattaaaagctggtaatgatccgattgccaaggctactttagagcag
ttttttgtgtttttagggcgagtcattggtaaccttgtattgtctgttgaagcgcgaggc
ggtgtgtatattgctggcggtattgtgcctcgctacttaaaggaaatattgtgcagtggc
tttagagaagctatgcaagacaagggtcgtatgaaagagtttgtttcaccgattccgact
tttgttgtgatgtctgaatacccagggctgatgggatgtgcttgctacgcttcctatctt
gtgtcgaaagcctag

DBGET integrated database retrieval system