KEGG   Marinomonas posidonica: Mar181_2848Help
Entry
Mar181_2848       CDS       T01508                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpc  Marinomonas posidonica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mar181_2848
   01230 Biosynthesis of amino acids
    Mar181_2848
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mar181_2848
   00051 Fructose and mannose metabolism
    Mar181_2848
   00562 Inositol phosphate metabolism
    Mar181_2848
Enzymes [BR:mpc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mar181_2848
Exosome [BR:mpc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mar181_2848
  Exosomal proteins of bladder cancer cells
   Mar181_2848
  Exosomal proteins of melanoma cells
   Mar181_2848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3152710..3153462)
Genome map
AA seq 250 aa AA seqDB search
MIRQKIVAGNWKMNGSKASISSLVNGLLEMSESSAEVVVTPPFPYLSQVADVIAQQSGLV
LAAQNLSQYEKGAYTGEVSTAMLTDFKVTYVLVGHSERRSLYGETDEVVAEKVKMALSAG
LKPILCIGETLEEREAEQTLLVCERQVAAVIDVVGIQAFENIVIAYEPVWAIGTGLSASA
QQAQDVHQAIRANLASLSTPVSEKVQILYGGSVKASTSAELFTMPDVDGALVGGASLDAK
EFLDIVKAAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgattcgacaaaaaatagtagctggaaactggaagatgaatggttcgaaagcgtcaatt
tcgagcttggttaacggtctattagagatgtcagaatctagtgctgaagtggttgttact
cccccatttccttatctttcacaagtggcagatgttattgctcagcaaagtggactagta
ctggctgcgcaaaacctcagtcagtatgaaaaaggggcttatacgggtgaagtttcaacg
gctatgttgacagacttcaaggtgacttatgttctagtgggtcactcagagcgacgttct
ttgtatggtgaaacagacgaagtggttgctgaaaaagtgaagatggctttgtcagcaggt
ttgaaacccattttgtgtatcggtgaaacgctagaagagcgtgaagctgagcaaactttg
cttgtttgtgagcgtcaagttgccgcggtgattgatgtggttggcattcaagcgtttgag
aatatagtcattgcttatgagccagtttgggcgattggtactgggttatctgccagtgcg
caacaggcacaagatgtgcatcaagcaattagagccaatttggcaagcttatctacaccg
gtttctgagaaagttcagattctttatggtggtagtgtaaaggcctcaaccagtgcagag
ttatttaccatgcctgatgttgatggtgcccttgtgggtggcgcatctttggatgcaaaa
gaatttttagacatagttaaagcagcaggttaa

DBGET integrated database retrieval system