KEGG   Marinomonas posidonica: Mar181_3023Help
Entry
Mar181_3023       CDS       T01508                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mpc  Marinomonas posidonica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mar181_3023
Enzymes [BR:mpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mar181_3023
Exosome [BR:mpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mar181_3023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3339326..3340315
Genome map
AA seq 329 aa AA seqDB search
MTFPYTRMRRMRKHDFSRRLMREHRLTADDLIYPMFILEGEQVREAVPSMPNIERVSIDF
LLEEAKELVELGIPTVALFPVIAADKKSLLAEEAYNPDGLVQRAVRALKQAFPELGVLTD
VALDPYTTHGQDGIIDDDGYVLNDVTVDTLVKQALSHAQAGADVVAPSDMMDGRIGEIRE
ELETEGFINTLIMAYAAKYASAYYGPFRDAIGSSGNLGKGNKFTYQIDPANSNEAIREVM
LDLDEGADMVMVKPGLPYLDIVRRVKSELEVPTFAYQVSGEYAMHMAAFEKGWLDKDSVM
MESLLAFKRAGADGILTYFAKDAARLLKG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacctttccatacactcgtatgcgccgcatgcgtaagcacgatttttctcgtcgtttg
atgcgcgagcatcgactcactgcagacgatctaatctacccaatgttcattcttgaaggg
gaacaagtccgtgaagcggttccttcaatgccaaacattgaacgtgtctcaattgatttc
ctgttagaagaagccaaagaactggttgagctcggcattccaactgtggcgttatttccg
gtcatcgcggcagataaaaagtctctactcgccgaagaagcttacaacccagatggtctc
gttcaacgagccgttcgtgcgctaaaacaggccttcccagagcttggcgtcttaaccgat
gtggcacttgatccttacaccacacatggacaagacggcatcatagacgatgacggctat
gtattgaatgacgtcaccgtagacacgcttgtaaagcaagccttgtctcatgctcaagct
ggcgctgatgtggtcgctccttcagacatgatggacggtagaattggtgaaatccgtgaa
gaactagaaacagaaggctttattaacaccttgatcatggcgtatgccgcaaagtacgca
tcggcttactatggtccattccgtgacgcaattggttccagcggcaatcttggtaaaggg
aacaagtttacctatcagattgatccggcaaactctaatgaagccatccgagaagtcatg
ttggatctagacgaaggggccgacatggtgatggtgaaaccagggttaccctacttggac
atagttcgtcgtgttaaaagtgaattagaagtacctacctttgcctatcaggtcagcggt
gagtacgccatgcacatggccgcttttgaaaaaggctggttggataaagactctgtgatg
atggagtctctgctggcgtttaagcgcgcgggggcagacggcatattaacctatttcgca
aaagacgcagcacgcctgctgaaaggttaa

DBGET integrated database retrieval system