KEGG   Marinomonas posidonica: Mar181_3030Help
Entry
Mar181_3030       CDS       T01508                                 

Definition
fomramidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mpc  Marinomonas posidonica
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Mar181_3030
Enzymes [BR:mpc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Mar181_3030
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Mar181_3030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3348281..3349099)
Genome map
AA seq 272 aa AA seqDB search
MPELPEVETTLRGIEAHLVGRKLVQVDIRQPQLRWLITPELRTEMVGQEITHLSRRGKYI
GIHTAKGTLIIHLGMSGSLYFVPANTPPLFHDHVDFCFAGDGDWLRYTDPRRFGAILWTT
EDWQTHDLLRHLGPEPLTDDFNVDYLYAKAKGRKMPIKTFIMDSKVVVGVGNIYANEALF
KAGIRPNRMAGNISKVRMRKLVECIKIVLANAIKQGGTTLKDFVGGDGKPGYFKQELAVY
GRAGLPCTQCQKVLTEVRQAQRSTVYCAKCQT
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccggaagtagaaaccacactgcgtggcattgaagcgcatttagtcggg
cgaaaacttgttcaagtggatattcgccagccgcaattacgctggttgattaccccagag
ttgcgcactgaaatggtggggcaagaaattactcacttatcacgacgtggaaaatacata
ggtattcataccgccaaaggtactttgatcattcatttaggcatgtcaggcagtttgtat
tttgtgccggccaatacaccacctttgtttcatgatcatgtggacttttgttttgcgggt
gatggtgactggttacgctataccgacccaaggcgtttcggtgctattttgtggaccacc
gaagattggcaaactcatgatttattacgtcatcttggtcctgagcctttaacagatgac
tttaatgtggactatctatacgccaaagctaagggacgtaaaatgcccatcaagactttt
attatggacagtaaagtcgtggttggggtgggcaacatatacgcaaatgaagcgttgttt
aaggccggtattcgcccaaatagaatggcgggaaatatttccaaagttagaatgcgtaaa
ttggttgagtgcattaaaatagtgcttgccaatgccatcaagcagggcggcaccacatta
aaagattttgtcggtggtgacggtaagcctggttactttaagcaagagttggcggtttat
ggtcgagctggcctgccatgtacccagtgtcaaaaggttttgacggaggttcgacaggca
caacgcagtacagtgtattgtgcaaaatgccaaacctga

DBGET integrated database retrieval system