KEGG   Marinomonas posidonica: Mar181_3041Help
Entry
Mar181_3041       CDS       T01508                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00010  Glycolysis / Gluconeogenesis
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01120  Microbial metabolism in diverse environments
mpc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mar181_3041
Enzymes [BR:mpc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Mar181_3041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEF56068
JGI: Mar181_3041
UniProt: F6D1H9
Position
complement(3357010..3357930)
Genome map
AA seq 306 aa AA seqDB search
MNGQLMKELEELGGEIRPASLKKCDEIIIDQPGFSAVIALWGGHLVSFTPSGQPDLLFQS
ENKGGEGRFGRRHFGVPVCWPWFGANEEQEDFPAHGLARYFRWEFIEAGRFKNGDVKIVI
RLASEDHPLIEEMWPYAFELRQVFRFSSKGFRINFTAANLSDKPMPVSEALHTYFHVADN
KTAQVHGLDQVTYVDKFDEGREYQQQGVVTPCNHMDRVYVSSPEECEIHDPDMQRRLIIQ
TEGSGSTVLWNPGGKLAKKRADMDKEDYCRFVCVEAGNALSDAYVIAPGEIHQLKLKVKH
KPLMED
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatggccaactgatgaaagagttggaagagctggggggggaaatacgccccgcaagc
ttaaaaaaatgtgatgaaattatcatagatcaacctggctttagcgccgtcattgctcta
tggggtgggcatctggtgagctttacaccgtctggtcaacctgatctcctttttcaatcg
gagaacaaaggtggtgaaggccgttttgggcgtcgccattttggtgtgcctgtatgctgg
ccttggtttggtgccaatgaagagcaagaagattttcccgcacacggattggcacgttat
tttcgttgggagtttattgaagctgggcgctttaaaaatggcgatgtgaaaattgtgatt
cgtctagcctcggaagaccatccgttgattgaagaaatgtggccttatgcctttgaattg
cggcaagtgtttcgtttctccagcaagggttttcgcattaattttaccgctgcgaatcta
tccgataagccaatgccagtgagtgaagccttacatacttatttccatgtggctgataat
aaaaccgcgcaagtacatggcttggatcaagttacgtatgttgataaatttgatgaaggt
cgtgaatatcagcagcaaggcgtagtgacaccttgcaatcatatggatcgagtgtatgtg
tcatcgccagaagaatgtgagattcatgaccctgatatgcagcgtcgcttgattattcaa
acggaaggcagtggcagtacagtattgtggaatccgggtggcaagttggcaaagaaacgt
gccgatatggacaaagaggattattgtcgctttgtttgtgttgaagccggtaatgccttg
tcagacgcttatgtgattgcgccaggtgagattcaccaattgaagctaaaggtgaagcat
aagccgctaatggaagactag

DBGET integrated database retrieval system