KEGG   Methanocella paludicola: MCP_0060Help
Entry
MCP_0060          CDS       T01142                                 

Definition
putative thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mpd  Methanocella paludicola
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MCP_0060
Enzymes [BR:mpd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MCP_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
52224..53735
Genome map
AA seq 503 aa AA seqDB search
MKLKAQPYDIEVGRYEIIVNALDADELGIHAGDRVQVKNRDTITAVVETTDAIVPQGRLG
IYREAWEALKAVPDEVVDVLPASKPSSVSSIKKKMDRQKLTNEELHDIIADIVDGNLTEV
ELTAFVTASYIYGMDADEIEWMTRAMVKTGDQISFDTHPVMDHHSIGGVPGNKITLCVVP
IIAAAGLLIPKTSSRAITGAGGSADLMEILAPVSFSAEDVKKMTTKVGGCIVWGGATNIA
PADDKIISVEYPLSIDPKSQLIASVMAKKYAVGADTMVLDIPMGNESKIPTIQEARKLAR
DFIDLGDRLKMRVECAITYGGSPIGRTIGGGLEVREAMAMLEKYEGPTSFMEKTIAISGM
MLEMGGVSAKGEGQKMAAEIVKSGKALKKFKEIIEVQGGDPNVTSEQVPVGDKVATVLSP
QDGYVLEIYNKRLVAVCRIAGAPHDKGAGILIHKKKGEYVKKGDGLFTIYADKEWKLDAA
IKESLRDPIMFVEGMILEKVQVV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaagctaaaggcacagccatatgacatcgaggtagggcgatacgagatcatcgtcaac
gcgctggacgcggacgagctgggaatacacgccggggaccgcgtgcaggtcaagaacagg
gacacgatcaccgccgtcgtggagacgacggacgccatcgttccccagggcaggctggga
atataccgggaggcatgggaggcgctcaaggcggtgccagacgaggtggtcgacgtgctg
cccgcgagcaagccaagctcggtctcgtccataaagaaaaaaatggacaggcagaagctt
actaacgaggagctgcacgacatcatcgcggacatcgtcgacggcaacctcaccgaggtg
gagcttacggccttcgtcacggcctcttacatctacggcatggacgccgacgagatcgag
tggatgaccagggccatggtcaagacgggcgaccagatctcgttcgacacgcacccggtc
atggaccaccacagcatcggcggcgtgcccggcaacaagatcacgctgtgcgtggtgccc
atcatcgcggccgcgggcctgctaataccgaagacgagcagccgggccatcaccggcgcc
ggcggcagcgccgacctgatggagatcctggcgcccgtgagcttcagcgccgaggacgtc
aagaagatgaccacgaaggtgggcggctgcatcgtgtggggcggcgcgacgaacatcgcc
cccgcggacgataagataataagcgtcgagtacccgctctccatcgacccgaaatcgcag
ctcatcgcctccgtcatggccaagaagtacgccgtgggcgcggacaccatggtgctggac
atccccatgggcaacgagtccaagatccccaccatccaggaggccaggaagctggccagg
gacttcatcgatctgggggacaggctgaagatgcgcgtggagtgcgccatcacgtacggc
ggctcccccatcggcaggaccatcggcgggggcctggaggtcagggaggccatggccatg
ctcgagaagtacgagggccccacgagcttcatggagaagaccatcgccatctcgggcatg
atgctggagatgggcggcgtgtccgcgaagggcgagggccagaagatggccgccgagatc
gtgaagagcggcaaagcgcttaaaaagttcaaggagatcatcgaggtccagggcggcgac
ccgaacgtcacgtccgagcaggtcccggtgggcgacaaggtcgcgaccgtgctctccccg
caggacggctacgtgctcgagatatacaacaagcgcctcgtggccgtgtgccgcatcgcc
ggcgcgccccacgacaagggcgccggcatactcatccacaagaagaagggcgagtacgtg
aagaagggcgacggcctgttcaccatttacgccgataaggaatggaagctggacgctgcg
atcaaagagtcgctgagggacccgatcatgttcgtcgagggcatgatcctggagaaggtg
caggtcgtataa

DBGET integrated database retrieval system