KEGG   Methanocella paludicola: MCP_0419Help
Entry
MCP_0419          CDS       T01142                                 

Gene name
acsA
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpd  Methanocella paludicola
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCP_0419 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCP_0419 (acsA)
   00620 Pyruvate metabolism
    MCP_0419 (acsA)
   00640 Propanoate metabolism
    MCP_0419 (acsA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCP_0419 (acsA)
   00680 Methane metabolism
    MCP_0419 (acsA)
Enzymes [BR:mpd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MCP_0419 (acsA)
Lipid biosynthesis proteins [BR:mpd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MCP_0419 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
419723..421435
Genome map
AA seq 570 aa AA seqDB search
MIGDCNVCYDEACGSGFCFDDVRKEFDWYTTGKVNIGYEAIDRHAKSWRKNKVALYWEGA
DGSDRKYTFQEFKIRTDKFANVLRKAGVKKGDRIFVYLPRIPELYASAISIAKLGAIFAP
LFGGFRAEAVRDRINDAEACMVITTPEMKRLGIDPIRKDIPSVKTVVLCNIPRNYDLEPG
DLSYDAEMIYASEEFEPEWCDLEDPVIMHYTSGTTGKSKGVVHVHNAMIGHYITTKWVQD
LRDDDVYWCTADPGWVTGTSYGIFGPWLNGASQVVYAGRFSPEAWYWIIDKYKVTVWYTA
PTALRMLMKGGEDVVKKYHLDSLRYITSVGEPLNPEVIRWGMRVYGLPIHENYWMTETGC
NVIANFYGMPLKIGSMGKPFPGIEAAVIDDKGKVLPPGVPGNIAIKPGWPSMMRSIWNNP
AKYNEYFRISGWYITGDSAFMDADGYFWFTGRIDDVIKTSGERVGPFEVESALLEHPAVA
EAGVIGKPDPLYGNVIKAFISLKPGYDGTEELKREISESVKKSLAAHAFPREIEFKASLP
KTRSGKIMRRVLKAMELGQPLGDLATLDDE
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcgattgcaacgtctgctacgacgaggcctgcggcagcggcttctgctttgac
gacgtcaggaaagagttcgactggtacactacgggcaaggtcaacatcggctacgaggcc
atcgaccgccacgcgaagtcctggcgcaagaacaaagtggccctttactgggaaggcgcc
gacgggagcgaccggaagtacacgttccaggagttcaagatacgcaccgataagttcgcg
aacgtgctccggaaagcgggcgtcaagaaaggcgaccgcatcttcgtctacctgccccgg
atccctgaactatacgccagcgccatctcgatcgccaagctgggcgcgatcttcgccccg
ctgttcggcggcttcagggcggaggcggtgagggaccgcatcaacgatgcggaggcctgc
atggtcatcaccacgcccgagatgaagcggctgggcatcgaccccatacggaaggacatt
ccgtccgtcaagaccgtcgtgctctgcaacatcccccggaactacgacctggagccgggc
gacctgagctacgacgccgagatgatctacgcctcggaggagttcgagcccgagtggtgc
gaccttgaagatccggtgatcatgcactacacgtcgggcacgaccggcaagtcgaagggc
gtcgtccacgtccacaacgccatgatcgggcactacattaccacgaaatgggtgcaggac
ctgagggacgacgacgtgtactggtgcacggctgaccccggctgggttacgggcacttca
tacggcatattcgggccctggctgaacggcgcctcgcaggtagtgtatgcaggccggttc
tcgcccgaggcctggtactggatcatcgacaagtacaaggtgaccgtctggtatacggcc
cccacggcgctccgcatgctcatgaagggcggcgaggacgtcgtgaagaagtaccacctg
gacagcttaaggtatatcacgagcgtcggcgagcccctgaacccggaggtcatccgctgg
ggcatgcgggtctacggcctgcccatccacgagaactactggatgacggagaccggctgt
aacgtcatcgccaacttctacggcatgcccctgaagataggctccatgggtaagcccttc
ccgggcatcgaggcggcggtcatcgacgataagggcaaagtgctgccccccggcgtgccc
ggcaacatcgccataaagcccggatggccctccatgatgcggagcatctggaacaaccct
gccaagtacaacgagtacttccgcatttcgggctggtacatcacgggggacagcgcgttc
atggatgcggacggatacttctggttcaccggccgcatcgacgacgtcatcaagacgtcg
ggggagcgcgtcgggcccttcgaggtggagagcgcgctgctcgagcatccggccgtggcc
gaggcgggcgttatcggcaagcccgatccgctgtacggtaacgtcatcaaggccttcata
tccctgaagcccggctacgatggcacggaggagctgaagcgcgagatctccgagtcggta
aagaaatccctcgcggcccacgcgttcccccgggagatcgagttcaaggcgagccttccg
aagacccggagcggcaagatcatgcgccgcgtgctgaaggcgatggagctgggccagcct
ctgggagacctggccacgctcgacgacgagtaa

DBGET integrated database retrieval system