KEGG   Methanocella paludicola: MCP_0517Help
Entry
MCP_0517          CDS       T01142                                 

Definition
putative dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mpd  Methanocella paludicola
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MCP_0517
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MCP_0517
Enzymes [BR:mpd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MCP_0517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
509447..509926
Genome map
AA seq 159 aa AA seqDB search
MSQRSIDGVMTRQLRLNVDERGSLMEVMRPDWDVFERFGQVYVTSAYPGVVKGWHYHKKQ
YDNFVCVRGMMKVALFDSRDNSPTKGLLNEFFIGERNPLLVKIPPYVYHGFKCIGTNEAL
IVNVPTGLYDYNEPDEYRLPPDTKEIPYDWGLTPGLMHG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacgatcgatcgatggggtaatgacgcggcaattgcgcctgaatgtggacgag
cgcggctctctcatggaggtcatgcgcccggattgggacgttttcgaaaggttcgggcag
gtatatgttacttcagcttaccccggcgtcgtgaagggatggcactatcacaagaagcag
tatgataactttgtttgtgtcaggggcatgatgaaggtggccctgttcgacagccgggat
aactcgccgacgaaaggcctgctcaacgaatttttcatcggcgagagaaatcctctgctt
gtaaagatcccgccatatgtatatcatggctttaagtgcatcggcacgaatgaggccctg
atcgtgaacgtgccgaccgggctctacgattataacgagccggatgaataccggttacct
cctgatacaaaagagataccctacgactggggcttaacccctggcctgatgcatggataa

DBGET integrated database retrieval system