KEGG   Methanocella paludicola: MCP_0794Help
Entry
MCP_0794          CDS       T01142                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpd  Methanocella paludicola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCP_0794
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCP_0794
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MCP_0794
Enzymes [BR:mpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MCP_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
780877..782034
Genome map
AA seq 385 aa AA seqDB search
MHVRYLQCVRCGRTYPKGEIRYRCDCGDSIEIVYDYAELMGHISWADLRKRTFCHWRYRE
FYPELKKKNIISMGEGGTGLVRSRNVVKKAGCRELLFKMESLNPTGSFKDRGSTVEISQA
KAYGAPELVLASTGNMGASVAAYTARGGIGCGIYVPKNTPRIKLLQMEAHGAAIKRVNGD
YTAAMVEARRQFDENHVYLAGDYPYRSEGEKSVSFEIADVLGSDYDYIAVPVGNGTLLHG
MWKGLKELTLLGLIDRLPKIIGVQAEGCNTVAKAFMCNTDRIEPVLPHTLMDAVACGDPL
DGSWALRALKESKGIAVTCSDNEASCARNMLALEEGIFAELSGALSTAGLIKAYEQGQIE
NDARVVSVITGHGLKEPEAFKCRVD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcaggtacctccagtgcgtccggtgcggccgcacgtacccgaaaggggagata
cgctaccgttgcgactgcggggacagcatcgagatcgtctacgattacgctgaattgatg
ggccacattagctgggcagacctgaggaagcgtacgttctgccactggcggtaccgggag
ttctatcctgagctgaagaaaaagaacatcatctccatgggcgagggcggcaccggcctc
gtgcggtcgaggaacgtcgtgaaaaaggccgggtgcagagagcttctttttaagatggag
agcctgaacccgacggggtcattcaaggaccggggctcgacggtcgagatatcccaggcg
aaggcgtatggcgccccggagctcgtgctcgcgtcgaccgggaacatgggcgccagcgtg
gccgcctataccgcccgtggcggcatcggctgtggcatatacgtcccgaagaacacgccc
cgcatcaagctgctccagatggaggcacacggggccgccataaaaagggtaaatggcgac
tatacggccgcaatggtggaggcccgtcggcagttcgatgaaaaccatgtgtatctcgcc
ggcgactacccgtacaggagcgagggcgaaaaatccgtaagcttcgagatcgccgacgtg
ctgggctccgactacgactatatcgccgtgcccgtcggcaacggcacgctcctccacggc
atgtggaagggcctgaaggaattgacgcttctgggcttgatcgaccgcctgccgaagatc
atcggcgtgcaggccgaagggtgtaataccgtggcgaaggctttcatgtgcaatacggac
cgtatagagcccgttctgccacatacgctcatggatgccgtggcctgtggagacccgctg
gacgggagctgggcgctgcgtgctttaaaggagtcaaagggcattgccgtcacgtgctcg
gacaatgaggcgagctgtgcccggaatatgctggcccttgaggagggcatctttgccgag
ctgtccggtgctttgagcactgccggattgatcaaggcctacgagcagggccagatagaa
aatgacgcgcgagtcgtgtccgtcatcaccggccatgggctgaaggagcctgaggctttt
aagtgccgggtcgactaa

DBGET integrated database retrieval system