KEGG   Methanocella paludicola: MCP_0979Help
Entry
MCP_0979          CDS       T01142                                 

Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpd  Methanocella paludicola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCP_0979
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCP_0979
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MCP_0979
Enzymes [BR:mpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MCP_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(985684..986673)
Genome map
AA seq 329 aa AA seqDB search
MRFSCGRCGKSYPIDGLAYKCSCGGLFTLRKEGKESVDLPVSLGETNTPLLRKEIYGARV
YFKMDHQMPTGSFKDRGSVVLVNKLKEMGIGEVVEDSSGNAGASIAAYCAAAGIKCHIYV
PESTPAAKLKQISAYGADIVKVPGPRENAAKAAQEAAGKTYYASHVYNPLFFEGTKSMAY
ETYVQMGFPDTVFVPAGNGTMLIGAYIGFKELGFLPRLIAVQSENCCPLYNKFYDLPDAE
PKPTIAEGIAIAHPPRLEEMASAIRESGGSVMTVSDDEIRAANETLRHMGIYVEDTSAVV
VAGARRHFKNGINNMRKVVLPLTGSGLKT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttcctgcgggcggtgcggtaaaagctatccgatcgacggcctcgcctataaa
tgcagctgcggcggcctatttacgctccggaaggaagggaaagaaagcgtcgacctgccc
gtatcgctgggagagacgaacacgccgctcctgaggaaggagatctacggcgcccgagtc
tattttaaaatggaccaccagatgcccacgggctcgttcaaggaccggggctccgtggtg
ctcgtcaataagctgaaagagatgggcattggcgaggtggtcgaggattcttccggtaac
gccggggcctctatcgcggcctattgtgccgcggccgggatcaagtgccatatctatgtc
ccggaaagtacgcccgcggccaagctgaagcagatcagcgcctacggcgccgacatcgtg
aaggtcccggggcccagggagaacgctgcgaaagcagcgcaggaggcggcgggaaaaacg
tactacgcctctcatgtttataaccccctgttcttcgagggcaccaagtccatggcctat
gagacctacgtgcagatgggcttcccggataccgttttcgtgcccgcgggcaacggcacc
atgctcatcggcgcctacatcggctttaaggaactgggatttttaccgaggctgatcgcc
gtgcaaagcgagaactgctgccccctttacaacaagttctacgacctgcctgacgcagag
ccaaagccgaccatcgcagaggggatcgccatcgcccatccgcccaggcttgaagagatg
gcctcggccataagggagagcggtggcagcgtcatgaccgtatcggacgacgagatacgg
gctgctaatgaaacgctccggcacatgggcatttacgttgaggatacttcggccgtcgtc
gtcgccggcgcccggcggcacttcaagaacggcatcaacaatatgcggaaagtcgtcctg
ccgctcacgggctctggacttaagacatag

DBGET integrated database retrieval system