KEGG   Methanocella paludicola: MCP_1257Help
Entry
MCP_1257          CDS       T01142                                 

Definition
pyruvate synthase alpha chain
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mpd  Methanocella paludicola
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCP_1257
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCP_1257
   00020 Citrate cycle (TCA cycle)
    MCP_1257
   00620 Pyruvate metabolism
    MCP_1257
   00640 Propanoate metabolism
    MCP_1257
   00650 Butanoate metabolism
    MCP_1257
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCP_1257
   00680 Methane metabolism
    MCP_1257
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCP_1257
Enzymes [BR:mpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCP_1257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1240956..1242053)
Genome map
AA seq 365 aa AA seqDB search
MKKMATGNQAAALAVKESDVEVVAAYPITPQTEVVETIASFVETRQMKASYIRVESEHSA
LAACIGASASGARAFTATSSHGLLYMHEMIHWAAGARLPIVMANINRAVGPAWNIWAEHT
DSLSQRDTGWLQFYAATVQEVYDTVLMSYRLAEKVNLPTMVCMDGFILSHAIQPLEITQP
GDFIPPINIPHALDTNDPMSYGNLTAQNDYFKFRRAMHDAQKEANVECRSIEKEFAERFG
RKYGPTDEYRTEDADTVIVGMGTMAREAEVAVDLLRKEGMKAGSIRVRQFRPFPKLNIEG
KKVIVLDRDCSFGAGGILAQEIRFHHNVPVYNIIAGLGGQDVRYETIADLVRKAKPEGEF
WLGVD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatggcaacaggcaaccaggcggccgcgctcgcggtcaaggagtcggacgtc
gaagtggtcgctgcttatcctatcaccccgcagaccgaggtcgtggagaccatcgcgagc
ttcgtcgagacgaggcagatgaaggcgtcctacattcgtgtcgagagcgagcattctgcc
cttgcggcctgtattggtgcatccgcctccggagcccgggcatttaccgctacgtcgagc
cacggtttgctgtatatgcacgagatgatccactgggctgccggagcccgactccccatc
gtgatggccaacatcaacagggcggtcggccctgcctggaacatctgggccgagcacacg
gactcactatcacagcgcgacacgggatggctgcagttctacgcggcgacagtccaggaa
gtctacgatacggtactcatgtcatacaggctggccgaaaaggtcaacctgcctacaatg
gtctgcatggacggattcatccttagccacgccattcagcccctcgagatcacacagccg
ggcgacttcataccgcccatcaacataccgcacgcgctggacacgaacgacccgatgtcc
tacggcaacctgacggcccagaatgactacttcaagttcaggcgggccatgcacgacgcc
cagaaggaggccaacgtcgagtgccgctctatcgagaaggagttcgcggagcgcttcggc
cgcaagtacgggcccacggatgagtaccggacggaggacgcggatacggtcatcgtcggc
atgggcaccatggcacgggaagccgaggtggccgtcgacctgctgagaaaggagggcatg
aaggccggctctatcagggtcaggcagttccggccgttccccaagcttaacattgagggc
aagaaggtcattgtgctggacagggactgctccttcggcgccggcggcatactggcgcag
gagatccggttccaccacaatgtgcccgtctacaacatcatcgcaggcctcggcggccag
gacgtccgctacgagacgatagcggaccttgtgagaaaggctaagcccgaaggcgagttc
tggctgggggtggactaa

DBGET integrated database retrieval system