KEGG   Methanocella paludicola: MCP_1258Help
Entry
MCP_1258          CDS       T01142                                 

Definition
pyruvate synthase beta chain
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mpd  Methanocella paludicola
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCP_1258
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCP_1258
   00020 Citrate cycle (TCA cycle)
    MCP_1258
   00620 Pyruvate metabolism
    MCP_1258
   00640 Propanoate metabolism
    MCP_1258
   00650 Butanoate metabolism
    MCP_1258
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCP_1258
   00680 Methane metabolism
    MCP_1258
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCP_1258
Enzymes [BR:mpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCP_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1242050..1242955)
Genome map
AA seq 301 aa AA seqDB search
MNLMLDDIPEDEFLYKGNTACAGCSAMLALRYILKAAGPNTIIVNPACCSTVCQGTYPRS
AYGVPVLNIAFAAAAAAADGIASAARNKGKNIIVFAGDGGTVDIGIQALSGAIERNANIL
YVCYDNEAYSNTGMQKSGSTPYGAITTTTPTGRKDSKKDIDLIIMAHRPRYMASASSAYP
KDLFNKVQKALSIEGTKFIHVQCPCPSGWRYATEKSVELGKLAVRCGMWFLYEYEDGKLT
LNAPTKAALKRPAPLEDYVKPQGRFKGVDIERLQKEVNEGMGRIRDMANMDALEKAKEGS
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttgatgctggacgacatcccggaggatgaattcctctataaaggcaacacggcc
tgtgccgggtgcagcgcaatgctggcactgcgctatattcttaaggcggccggcccgaat
acgatcatcgtgaaccccgcatgctgctcgacggtatgccagggcacctatcccaggtca
gcttacggcgttcccgtgctgaacatcgcgttcgccgcagcggcggcagcggccgacggg
atcgcctcggcggcgcggaacaagggcaagaacatcatcgtcttcgcgggcgacggcggc
accgtggacatcggcatccaggcattatcgggcgccatcgagcgcaacgccaacatcctt
tacgtttgttatgataatgaggcctactctaacacgggcatgcagaagagcggctctacg
ccctacggcgccatcaccacgaccacgccgaccggcaggaaggactccaagaaggacatt
gacctgatcatcatggcccaccggccccggtatatggccagcgcgtcgtcggcctacccg
aaggacctctttaataaagtccagaaagccctgagcatcgagggcacgaagttcatccac
gtccagtgcccgtgcccgtccggctggcgctacgcgaccgagaagtcggtcgagctggga
aagctggcagtcaggtgcggcatgtggttcctctacgagtacgaggacggtaagcttacc
ttgaacgcccccacgaaggcagctttgaagaggcccgcaccgctggaagactacgtaaag
ccccagggccggttcaagggcgtcgacatcgagcgcctccagaaggaggtcaacgagggc
atgggtcgtatccgggacatggctaacatggatgcccttgagaaggcaaaggagggttcg
caatga

DBGET integrated database retrieval system