KEGG   Methanocella paludicola: MCP_1262Help
Entry
MCP_1262          CDS       T01142                                 

Definition
putative carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mpd  Methanocella paludicola
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MCP_1262
Enzymes [BR:mpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MCP_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1244779..1245726)
Genome map
AA seq 315 aa AA seqDB search
MAAMIATIGDINVDLIARIDRIPATGKQVVTRDLQMHGGGCSANFSLSCSRLGMGTQLFG
KVGDDVFGRYVLLELEDNGVDTANVLLTDKRTGMTFAMVQGIERSFITYQGENATLCLDD
IDISRISADIVHLPSYFLMDSLRHDYIKLIDLIHAAGIKVSFDTGWDPRGFIEETVGPLR
EILPKVDLFMPNMDEARNILKLGGDAGPEKAAGMLVGMGVKTAVVKVGEGGCWIADRNTS
EYVPAFKVDVVDTTGAGDNFAAGFISAYISGRTLRESAVIGSATAALKIGGVGWPAYPER
RQVNKFLSDRGFEGF
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttggcggcgatgatcgcgaccatcggcgacatcaacgtcgacctgatagcgcgaatagac
aggataccggccacgggtaagcaggtcgtcacgcgggacctccagatgcacggcggcggc
tgctccgcgaacttctcgctctcctgctccaggctggggatgggaacgcagctattcggc
aaggtcggcgacgacgtgttcggccggtatgtgctccttgaactggaggataatggcgta
gatacggcgaacgtgctgctcaccgataaaagaacgggcatgacattcgccatggtgcag
ggcatcgagcgctcgttcatcacataccagggcgagaacgccacactttgcctggacgat
atcgatatctcaagaatatccgcagatatcgtccatcttccctcgtactttttaatggac
agcctgcgacacgattacattaagctcattgacctgattcatgcggccggtatcaaggta
tcgttcgataccggctgggacccccggggattcatagaagagacggtaggcccgctccgg
gaaatattgccgaaagtggacctgttcatgccgaatatggacgaagccaggaacatttta
aaactgggcggagacgccgggccggaaaaggctgccgggatgctggtgggtatgggcgtt
aagacggcggtggtcaaggtcggcgaaggcggctgctggatcgccgaccggaacacgtcg
gagtatgtcccggcctttaaagtagacgtggtagatactaccggggccggcgataacttc
gcggccgggttcataagcgcgtacataagcggcagaacactgcgcgagtcggccgtgata
ggcagcgccacggcggccctcaagatcggcggcgtaggctggcccgcctatcctgagcgc
cgacaggtcaataaattcttgagcgataggggcttcgagggattttga

DBGET integrated database retrieval system