KEGG   Methanocella paludicola: MCP_1565Help
Entry
MCP_1565          CDS       T01142                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpd  Methanocella paludicola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCP_1565 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCP_1565 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MCP_1565 (thrC)
Enzymes [BR:mpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MCP_1565 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1572710..1573939
Genome map
AA seq 409 aa AA seqDB search
MYHLECIKCGAKYPADEVIYTCKKCDGLLDVVYDYSKIHLTREDLKGPLSVWKYKALLPV
SGEPVTLKEGGTPIYHMKKIGAEIGLKEAYAKHEGMNPSGSFKDRGMTVGVSKALELGMK
SVACASTGNTSASLAVYGARAGIPVIVLLPQGKVALGKVAQALMHGARVISVKGNFDDAL
RLVRELCIENGIYLLNSINPYRLEGQKTIGFEIVDYFGWEVPDRIILPVGNAGNITAIYK
GLNEMKKLGIIDRIPKMTGIQAEGSAPIAKAIKSGAANISVEEHPETVATAIRIGDPVNA
VKALNAIRKSGGTAETVTDEEILNAQKMLAVKEGIGVEPASAASVAGLIKLRNMGVIEDD
ERVVCVVTGHLLKDPETVIKNCDKPIEVEASEEAIEKVLGIKKMKVKAK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaccttgaatgcataaaatgcggcgcgaaataccccgccgacgaagtcatctac
acgtgtaagaaatgcgacggattactggacgtcgtgtacgattattctaagatacactta
acaagggaagacctgaaagggccgctgtcggtctggaagtacaaggcgctgctgcccgtt
agcggggagcccgttacgcttaaagagggcggtacgcccatctatcacatgaaaaagatc
ggcgccgagattggcctcaaggaagcttacgcaaagcacgagggcatgaacccgtcgggc
tcttttaaggacaggggaatgacggtcggcgtttccaaagcgcttgagctgggcatgaag
agcgtcgcatgtgcttcaacgggtaatacgtcggcttctcttgccgtatatggcgccagg
gccggcatcccggtcatcgtgctcctgccgcagggtaaggtagcgctgggcaaagtggct
caggcccttatgcacggggcgagagtgatcagcgtgaagggcaacttcgacgacgccctg
cgcctggtaagagagctctgcatcgagaacgggatatacctcttgaattccatcaacccg
tacaggctcgaaggccagaagaccatcggcttcgagatcgtggactatttcggctgggaa
gtgcccgaccgcatcatcctgcccgtgggcaatgccggcaacatcacggccatctataag
ggcctgaacgagatgaagaagctgggcatcatcgaccgtatcccgaagatgaccggcatt
caggctgagggtagtgcccctatcgcaaaggcaattaaatcaggtgctgctaatatctct
gtcgaagagcatcccgagaccgttgcgacagcgatccggatcggcgatccggtgaatgcc
gtgaaggcgctgaacgcgatacgtaaatccggcggaacggccgaaacagtgaccgatgaa
gagatactgaacgcacagaagatgctcgccgtaaaagagggcatcggcgtcgagccggcg
tctgcggcatccgtggcagggctcattaagctgaggaacatgggcgtcatcgaggacgac
gagcgggtcgtctgcgtcgtcaccggccacctgctcaaggacccggagacggtcatcaag
aactgcgacaagcctatcgaggtcgaggccagcgaagaagctatcgagaaagtcctgggc
attaaaaaaatgaaagttaaggctaagtaa

DBGET integrated database retrieval system