KEGG   Methanocella paludicola: MCP_1975Help
Entry
MCP_1975          CDS       T01142                                 

Definition
putative tryptophan synthase beta chain
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpd  Methanocella paludicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCP_1975
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCP_1975
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCP_1975
Enzymes [BR:mpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCP_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1984181..1985515
Genome map
AA seq 444 aa AA seqDB search
MVGKVITKSKDITRVTLDVEEIPKKWYNIAADLPGGLPPALNPGTKEPLKPEEWEAIFPK
GLIKQELSTDRFIKIPDEVRTALAQFGRPSPLYRARRLEKALRTPARIYYKREDLSPVGS
HKPNTAIAQAYYNFAEGIEHLTTETGAGQWGSALSMATAYFGMKCTVFMVRSSYDQKPYR
KYVMKLYGANVYPSPSDKTAFGRKTQAEDPDCPGSLGIAISEAIETAVGTPNSKYSLGSV
LNHVMLHQTVIGQEVRAQLAKIDERPDRMIACVGGGSNFAGFTFPFIYDKLKGKNDARFI
AVEPESVPSLTGCSSGESRYDYDFGDTAGMTPLLKMHTLGHDFMPDPIHAGGLRYHGMAP
TVSALYDKGMIEAEALPQDETFAAGMLFTRTEGLIAAPESCHAIASAIRHAQECKRENKE
EVIVFNLSGHGLLDLQNYATMLGM
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtcggaaaagtcattacgaagtcaaaggacattacgagggtaacgctggacgtcgaa
gagatccccaaaaaatggtataacatcgcggccgacctgcccggcgggctgccgcccgcc
ctgaacccgggcacgaaagagccgctgaagcccgaggagtgggaggccatattcccgaag
ggcctgatcaagcaggagctttctactgaccgttttattaagatccccgacgaggtccgc
acggcgctcgcccagttcggcaggccgtcgcccctgtacagggcccggcggctggagaag
gccctgaggactccggcgcgcatttattacaagcgggaagacctgtcgcccgtgggctcc
cataagccgaataccgccatcgcccaggcatactataatttcgccgaggggatcgaacat
ctgaccaccgagaccggcgcgggccagtggggctcggcactgagcatggcaacggcctat
ttcggaatgaaatgcaccgtgttcatggtgcgctcttcctatgaccagaagccttaccgt
aagtacgtcatgaagctctatggcgcgaacgtgtacccttcacccagcgataagaccgcg
ttcggccgaaaaacgcaggccgaggacccggattgcccgggcagcctgggtatcgccatc
agcgaggccatcgagaccgccgttggtaccccgaactctaaatactcgctgggcagcgtc
ctgaatcatgtaatgctccaccagaccgtcatcggccaggaggtcagggcgcagctcgcg
aagatcgacgagaggcccgaccggatgatcgcctgcgtgggcggcggtagtaacttcgcc
ggcttcacgttccccttcatctacgataagctgaagggcaagaacgacgcccgcttcatc
gccgtggagccggagagcgttccttcgcttaccggctgctcgagcggcgagtcccggtat
gattacgacttcggcgataccgccggcatgacccctctcttgaagatgcataccctgggc
catgatttcatgccagaccccattcacgccggtggcttgcggtatcatggaatggcgccg
accgtgtccgccctgtatgataagggcatgatcgaggccgaggcgctgccccaggatgag
accttcgctgcggggatgttgtttacccggacagagggccttatcgccgcccccgagtcg
tgccatgccatcgcttccgccattcggcacgcgcaggagtgtaagcgcgagaataaggag
gaggttatcgtctttaacctgagcgggcacgggctgcttgacctgcagaactatgccact
atgctgggcatgtaa

DBGET integrated database retrieval system