KEGG   Methanocella paludicola: MCP_1975Help
Entry
MCP_1975          CDS       T01142                                 

Definition
(GenBank) putative tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpd  Methanocella paludicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCP_1975
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCP_1975
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCP_1975
Enzymes [BR:mpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCP_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1984181..1985515
Genome map
AA seq 444 aa AA seqDB search
MVGKVITKSKDITRVTLDVEEIPKKWYNIAADLPGGLPPALNPGTKEPLKPEEWEAIFPK
GLIKQELSTDRFIKIPDEVRTALAQFGRPSPLYRARRLEKALRTPARIYYKREDLSPVGS
HKPNTAIAQAYYNFAEGIEHLTTETGAGQWGSALSMATAYFGMKCTVFMVRSSYDQKPYR
KYVMKLYGANVYPSPSDKTAFGRKTQAEDPDCPGSLGIAISEAIETAVGTPNSKYSLGSV
LNHVMLHQTVIGQEVRAQLAKIDERPDRMIACVGGGSNFAGFTFPFIYDKLKGKNDARFI
AVEPESVPSLTGCSSGESRYDYDFGDTAGMTPLLKMHTLGHDFMPDPIHAGGLRYHGMAP
TVSALYDKGMIEAEALPQDETFAAGMLFTRTEGLIAAPESCHAIASAIRHAQECKRENKE
EVIVFNLSGHGLLDLQNYATMLGM
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtcggaaaagtcattacgaagtcaaaggacattacgagggtaacgctggacgtcgaa
gagatccccaaaaaatggtataacatcgcggccgacctgcccggcgggctgccgcccgcc
ctgaacccgggcacgaaagagccgctgaagcccgaggagtgggaggccatattcccgaag
ggcctgatcaagcaggagctttctactgaccgttttattaagatccccgacgaggtccgc
acggcgctcgcccagttcggcaggccgtcgcccctgtacagggcccggcggctggagaag
gccctgaggactccggcgcgcatttattacaagcgggaagacctgtcgcccgtgggctcc
cataagccgaataccgccatcgcccaggcatactataatttcgccgaggggatcgaacat
ctgaccaccgagaccggcgcgggccagtggggctcggcactgagcatggcaacggcctat
ttcggaatgaaatgcaccgtgttcatggtgcgctcttcctatgaccagaagccttaccgt
aagtacgtcatgaagctctatggcgcgaacgtgtacccttcacccagcgataagaccgcg
ttcggccgaaaaacgcaggccgaggacccggattgcccgggcagcctgggtatcgccatc
agcgaggccatcgagaccgccgttggtaccccgaactctaaatactcgctgggcagcgtc
ctgaatcatgtaatgctccaccagaccgtcatcggccaggaggtcagggcgcagctcgcg
aagatcgacgagaggcccgaccggatgatcgcctgcgtgggcggcggtagtaacttcgcc
ggcttcacgttccccttcatctacgataagctgaagggcaagaacgacgcccgcttcatc
gccgtggagccggagagcgttccttcgcttaccggctgctcgagcggcgagtcccggtat
gattacgacttcggcgataccgccggcatgacccctctcttgaagatgcataccctgggc
catgatttcatgccagaccccattcacgccggtggcttgcggtatcatggaatggcgccg
accgtgtccgccctgtatgataagggcatgatcgaggccgaggcgctgccccaggatgag
accttcgctgcggggatgttgtttacccggacagagggccttatcgccgcccccgagtcg
tgccatgccatcgcttccgccattcggcacgcgcaggagtgtaagcgcgagaataaggag
gaggttatcgtctttaacctgagcgggcacgggctgcttgacctgcagaactatgccact
atgctgggcatgtaa

DBGET integrated database retrieval system