KEGG   Methanocella paludicola: MCP_2064Help
Entry
MCP_2064          CDS       T01142                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mpd  Methanocella paludicola
Brite
Enzymes [BR:mpd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MCP_2064 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2067142..2067699)
Genome map
AA seq 185 aa AA seqDB search
MSRVPRHLFVPDNVRENAYVDVPLPIGEGQTISAPSMVAIMCDVLDVRDGDSVLEVGTGW
GYHAAIMSVLAGHGMVYTVERLPSLAMRAREIYRDLGFINIDVVVGDGSQGLPEHAPYDR
ISVAAAAPAIPQPLVDELKDGGRMVIPVGQYYQDLYLVEKADGKVHTSTKGGVAFVPLVG
KYGFK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgggtgccccgtcatctttttgttcccgataatgtccgggagaacgcctatgtg
gatgtgcccctgcctatcggcgagggccagactatttctgccccgagtatggtcgccatt
atgtgcgacgtgctcgacgtccgtgatggcgacagtgtccttgaggtgggcacggggtgg
ggataccatgcggccatcatgtccgtattggctggtcacggtatggtctatactgtcgag
cgtttgccgtccctggcgatgagggcccgtgaaatataccgggatctaggttttatcaat
atcgatgttgtcgtgggcgacggcagccaggggctcccggaacatgcgccctatgaccgc
atcagcgtcgccgccgcagcgcccgcgataccgcagccgctggtcgacgaactgaaggat
ggcggcaggatggtcataccggtcgggcaatattaccaggatctttacctcgttgagaag
gccgatggtaaggtgcatacctctacaaagggcggcgtcgccttcgtgccgctcgtgggg
aaatacgggtttaaataa

DBGET integrated database retrieval system