KEGG   Methanocella paludicola: MCP_2301Help
Entry
MCP_2301          CDS       T01142                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpd  Methanocella paludicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCP_2301 (ruvA)
Enzymes [BR:mpd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MCP_2301 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2258627..2259217
Genome map
AA seq 196 aa AA seqDB search
MIAHLEGRLEYKGHERIVIDVGGVGYDVRVPTHLYDLIPAEGERCKVFIHTYFREEDGTS
LYGFTTWQDREFFKLLMTVSGIGPKVALGIMSSITASDLAEAIVVEDAKALTRVNGVGKK
MAQRLILELKDKVAEMSIENRAKKPGADMTSEDATSALVALGYSRQAASAAVARARDASP
GLSKVEELIKTSLRYL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgcatcttgaaggaaggctggaatacaaagggcatgagaggatagtaatagat
gtgggcggcgtgggctacgacgtgcgggtgcccacgcatttgtacgacctcatcccggcg
gaaggagagaggtgcaaggtgttcatccacacctatttcagggaggaggacgggacttcc
ctgtacgggttcacgacctggcaggaccgggagttcttcaagctgctgatgaccgtgtcg
ggcatcggccccaaggtggcgctgggcatcatgtcgagcatcaccgcctcggacctggcg
gaggcgatcgtcgtcgaggacgcgaaagcgctgacgagggtcaacggcgtagggaagaag
atggcgcagcgccttattctggagcttaaggataaggtggccgagatgagtatcgagaac
cgcgctaagaagcccggggcggacatgacatcggaggacgcaacgtccgcgctggtggcg
ctgggctatagccggcaggcagcgtcggccgcggtcgcgagggccagggatgcgtcgccg
ggcctgtcgaaagtcgaagagctgataaaaacatcgctaaggtatctatga

DBGET integrated database retrieval system