KEGG   Methanocella paludicola: MCP_2366Help
Entry
MCP_2366          CDS       T01142                                 

Definition
histone acetyltransferase Elp3 homolog
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mpd  Methanocella paludicola
Brite
Enzymes [BR:mpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MCP_2366
Transfer RNA biogenesis [BR:mpd03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MCP_2366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2317276..2318871
Genome map
AA seq 531 aa AA seqDB search
MDKVSAACRELVSLIVSGDVSTQAELNKAKKMVSIAHGLSSLPRNSDILREAGEDYDAVL
GILQKRPVRTMSGVAVVAVMTSPHKCPHGKCVPCPGGVDSVFNSPQSYTGAEPAALRAIQ
ENYDPYRQVTARLSQLRQIGHELDKAELIVMGGTITARPLDYQQWFVKRCLDAMNDFGVD
PVHTKYLEDAQAANEEAAVRDVAMTFETRPDWCRTAHIDRMLDMGVTKVELGVQSTYDFI
LKRIERGHTVADSEEANRALRDSAIKVGFHMMPGLPGSGFDRDLRMFEAVFSDPRFCPDY
LKIYPTLVTRGTRLYDMWERGEYTPYSSEEAALLLARMKERLPKWVRLQRIQRDIPVKHI
AAGVVKSNVRQLAGDILRSEGKECRCIRCREIGHKAMKGLKGDPGSVRLDVVKYEACGGA
EHFISFEEPNIDALVGFTRLRFPSRPHRPELENAALVRELHVYGRMVPIGQSNENWQHRG
YGVELLSKATDMARDAGYGKLAVMSGIGARPYYKKLGFERDGPFMSIRIRA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtgagtgctgcctgccgggagctggtctcgcttattgtttcgggggacgta
tccacccaggccgagctaaataaggccaagaagatggtgagcatagcccatggcctgtcc
agcctgcctcgcaactccgacatactaagggaggccggcgaggactatgatgccgtgctc
gggatactccagaagcgccctgtgcggacgatgtcgggcgtggccgtcgtggcggtcatg
acctccccgcacaagtgcccgcacggcaagtgcgtaccgtgcccgggcggcgtggactcg
gtgttcaactcgccccagagctacacgggcgcagagccggcggcgctgcgggccatccag
gagaactacgacccgtaccgccaggtcaccgcccgcctgagccagctacggcaaataggc
cacgagctggacaaggccgagctgatcgtcatgggcggcaccatcacggcccggccgctg
gactaccagcagtggttcgtgaagcgctgcctggacgcgatgaacgactttggcgtcgac
cctgttcatactaaatacctggaggacgcccaggcggcgaacgaggaagctgcggtcagg
gacgtcgcgatgacgttcgagacccggcccgactggtgccgcacggcgcacatcgaccgc
atgctggacatgggcgtgacgaaggtcgaattaggcgtgcagagcacgtacgatttcatc
ttaaagcgcatcgagcgcggccacacggtggccgacagcgaagaggcgaaccgggcgctc
cgggactcggccatcaaggtcgggttccacatgatgcccgggctgccgggctcgggcttc
gacagggacctgcgcatgttcgaggcggtgttcagcgacccgcgcttttgccccgattac
ctgaagatctaccccacgctcgtcaccagaggcacgaggctatacgacatgtgggagcgg
ggcgagtatacgccctattcgagcgaagaagcggccctgctgctggccaggatgaaggag
cgcctgccgaagtgggtgcggctccagcggatccagcgggacatcccggtaaagcacatt
gccgccggcgtcgtcaagagcaacgtgaggcaactcgccggggatatcctccgcagcgag
ggaaaggaatgccgctgcatccggtgccgggagatcgggcacaaggccatgaagggcctg
aaaggagacccgggctcggtgaggctcgacgtggtaaaatacgaggcctgcggaggcgcc
gaacacttcatatcattcgaggagccgaacatcgacgcgctcgtcggcttcaccaggctc
cggttcccctcgaggccccatcgcccggagcttgagaacgccgcgctggtcagggagttg
cacgtctacggcaggatggtgcccataggccagagcaacgaaaactggcagcataggggc
tatggcgttgagctattgagcaaggcgacggacatggcgagagatgcgggctacgggaag
ctggcggtcatgagcggcatcggcgccaggccgtattataagaagctcgggttcgagagg
gacggcccctttatgtccatacgtatacgggcctga

DBGET integrated database retrieval system