KEGG   Methanocella paludicola: MCP_2372Help
Entry
MCP_2372          CDS       T01142                                 

Definition
putative carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mpd  Methanocella paludicola
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MCP_2372
Enzymes [BR:mpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MCP_2372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2323991..2324935)
Genome map
AA seq 314 aa AA seqDB search
MPKIATIGDVNVDLIARIDRMPELGKQVITRDFQTHGGGCSANFSLSCARLGMETQLFGK
VGDDVFGTYVLVELEDNHVDTKNVMLTDNKTGVTVAMVQGIERSFITFRGENATYSLNDI
DVSKIRADIAHLPSYFLLDGLRNDYAKLIDVLHAAKVQVSFDTGWDPRGFMRETVDPLFD
ILPRVDVFLPNIDEARSILGLDTRIGPERAAEILLDMGVKVVAIKMGKDGCWVATKESIE
YVPAFSVKVVDTTGAGDNFNAGFISSYISGKPLNECAIVGSATAALKIGGVGWSTYPTRK
QVNTFLAERGYTGL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaatagccaccataggggacgtcaacgtagaccttatagcgagaatagaccgc
atgcccgagctgggcaagcaggtcataaccagggacttccagacgcatgggggaggctgt
tctgctaatttttcgctctcctgcgcccggctggggatggagacacagctcttcggcaag
gtcggggacgacgtgttcggcacttacgtgctggtggagctggaggacaaccacgtcgac
acgaagaacgtcatgctcaccgacaataagacgggcgtcaccgtggccatggtgcagggc
atcgagcggtcgttcatcacgttccgcggcgagaacgcgacgtatagcctgaacgacatc
gacgtctcgaagatacgggcggacatcgcccacctgccgtcctactttttgctcgacggg
ctgaggaacgactacgcgaagcttattgacgtattgcacgcggcgaaggtgcaggtgtcg
ttcgacactggatgggacccccgcgggttcatgagagagacggtcgacccgctcttcgat
atactgccccgggtcgacgtgttcctgcctaacatcgatgaggcgcgcagcatcctgggg
ctggacacgaggatcgggcccgagagggccgccgagatcctgctggacatgggcgtgaaa
gtcgtagccatcaagatgggcaaggacgggtgctgggtggcgacgaaggagagcatcgag
tacgtgcccgccttcagcgtgaaagtggtcgacacgacgggcgccggcgacaacttcaac
gccgggttcatcagctcctacatcagcggcaagccactgaacgagtgcgccatcgtcggc
agcgccacggcggcgctgaagatcggcggcgtaggatggtcgacatacccgacgcgcaaa
caggtcaatacatttttagcggagcgaggctatacgggcctttaa

DBGET integrated database retrieval system