KEGG   Methanocella paludicola: MCP_2422Help
Entry
MCP_2422          CDS       T01142                                 

Definition
(GenBank) phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mpd  Methanocella paludicola
Pathway
mpd00010  Glycolysis / Gluconeogenesis
mpd00030  Pentose phosphate pathway
mpd00051  Fructose and mannose metabolism
mpd00052  Galactose metabolism
mpd00230  Purine metabolism
mpd00500  Starch and sucrose metabolism
mpd00520  Amino sugar and nucleotide sugar metabolism
mpd00521  Streptomycin biosynthesis
mpd01100  Metabolic pathways
mpd01110  Biosynthesis of secondary metabolites
mpd01120  Microbial metabolism in diverse environments
mpd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCP_2422
   00030 Pentose phosphate pathway
    MCP_2422
   00051 Fructose and mannose metabolism
    MCP_2422
   00052 Galactose metabolism
    MCP_2422
   00500 Starch and sucrose metabolism
    MCP_2422
   00520 Amino sugar and nucleotide sugar metabolism
    MCP_2422
  Nucleotide metabolism
   00230 Purine metabolism
    MCP_2422
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MCP_2422
Enzymes [BR:mpd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MCP_2422
    5.4.2.8  phosphomannomutase
     MCP_2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: BAI62494
NITE: MCP_2422
UniProt: D1Z1C2
Position
2375777..2377114
Genome map
AA seq 445 aa AA seqDB search
MGLFGTNGVRGIANVELTTEMAMNLAKGFGTFRPGTIAVGRDTRESGEMIKASVIAGLLS
TGCKVVDLGIAPIPAVQNYVKQCKLDGGIMVTASHNPPEYNGIKGIAKDGTEYSHEDEAV
VEKLYYSHAFARAQWSQTGGLSYADPKPLYIDGIVSTVDAEAIGNKKFKVVADPGSGAAS
LTTPFLLRKLGCKVVTLNAQVDGTFPGRNPEPTGNEINDLKAAVVSAGADLGVAHDCDAD
RAVFVDEKGRFVNEDVLLAIMTEHILKKSPGATIVTPVSSSSLIQDIADKYDAKVIWTQV
GSIYVARTMMATGAVFGGEGNGGLIFPKFQYCRDGGMSAASMLEMLAHTGKKLSEIIDSM
PAYHSVKDKIKCKDKEAVIQAIEAYTKGENVDNTDGLKIYRPEGWVLIRMSGTEPIIRVF
AESRSAEGAKKLADYGVGLVNQFNK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggattattcgggacgaatggcgttagaggcatagcgaatgtggaattgacgaccgag
atggcgatgaacttagcgaagggtttcggcacgttcaggccgggcaccattgccgtgggg
cgggatacgagggagtcgggagagatgatcaaagcctcggtcatcgccgggctcttatcg
acgggctgtaaggtcgtagaccttggcatcgcccccatcccggcggtccagaactacgtg
aagcagtgtaagctggacggcggcatcatggtcacggcctcgcataaccctcccgagtat
aacggcatcaagggcatcgcgaaggacggcaccgaatattcccacgaggacgaggccgtc
gtcgagaagctttattattctcacgcgttcgccagggcgcagtggagccagaccgggggc
ctgagctacgccgacccgaagcccctctacatcgacgggatcgtctctacagtggacgcg
gaagccatcgggaataagaagttcaaggtagttgcggaccccggcagtggcgctgccagc
ctgaccacgcccttcctcctgagaaagctgggctgtaaggtcgtcaccctcaacgcccag
gtggacggaacgttcccgggcaggaacccggagcccacgggcaacgagatcaacgacctg
aaggcggccgtcgtctcggccggcgcagacctgggagtggcccacgactgcgacgccgac
agggccgtatttgtggatgagaagggcaggttcgtcaacgaggacgtcctgctcgccatc
atgacggagcacatcctgaaaaagagccccggcgccaccatcgtcacgccggtcagctct
tcctcgcttatccaggacatcgccgataagtacgacgcgaaggtcatctggacccaggtg
ggcagcatctacgtggcccggaccatgatggccaccggcgccgtgttcgggggagaaggc
aacggagggctcattttcccgaaattccagtactgccgggacggcggcatgtccgctgcg
tcgatgctcgagatgctggcgcacacgggcaagaaattatcggagatcatcgactcgatg
cccgcctaccacagcgtcaaggacaagatcaagtgcaaggacaaggaggccgtcatccag
gcgatcgaggcctacacgaagggcgagaacgtcgataataccgatggccttaaaatttat
aggccggaaggctgggtactcatccggatgtccggcacggagccgatcatcagggttttc
gccgagtcgaggagcgcggaaggggccaaaaagcttgccgactatggcgtgggcctggta
aatcaattcaacaaataa

DBGET integrated database retrieval system