KEGG   Methanocella paludicola: MCP_2587Help
Entry
MCP_2587          CDS       T01142                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mpd  Methanocella paludicola
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCP_2587 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MCP_2587 (rocF)
Enzymes [BR:mpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MCP_2587 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2544174..2545091
Genome map
AA seq 305 aa AA seqDB search
MSKKDDVIGKVRIVGVPLDLGADRRGIDMGPDALRNDGLVEALEKLGIDVQDTGNIMLPP
RPPKKKYDSRLKNYEEVIFACQRVRDFVGRSIADGYFPLVIGGDHSIAMGTTAALSTFYN
KIGIIWIDAHGDFNTEDTTISGNIHGMSFATSCGRGSKNLVGKLGVRTSVSEANCVLIGA
RDLDPLERELLKKSNVTVFTMRDIDEQGMHKIMKKALKIACDGTDALHVSFDIDVMDPME
APGVGTPVQGGMTYREAHLAMEMISECPNLKSLEVVELNPILDRQNVTGKLAIGLISSAF
GKKIL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaagacgacgtcatcggcaaggtccgcattgtaggcgttccactggacctg
ggcgcagacaggcggggcatcgacatgggccccgacgccctgcggaacgacgggcttgtc
gaggcgctggagaagctgggcatcgacgtgcaggatacgggcaacatcatgctgcccccg
cggcccccgaagaaaaaatacgattcccggctgaagaactacgaggaggtcatcttcgcc
tgccagcgcgtgagggacttcgtgggcaggagcatcgccgacgggtattttcctttagtg
atcggcggcgaccacagcatcgccatgggcacgaccgcggccctgagcaccttctataat
aagatcggcatcatctggatcgacgcccacggcgacttcaatacggaagatacgaccatc
agcggcaacatccacggcatgagcttcgccacgtcctgcggccggggctcgaagaacctg
gtcggcaagctgggcgtcaggacgagcgtctccgaggccaactgtgtcctcatcggcgcc
cgtgacctggatcctttagagcgggagctgctgaaaaagtcgaacgtgacggtctttacg
atgcgggacatcgacgagcagggcatgcacaagatcatgaagaaggccctgaagatcgcc
tgcgacggcacggatgcccttcacgtttccttcgacatcgacgtcatggaccccatggag
gcgcccggcgtgggcacgcccgtgcagggcgggatgacctatcgcgaggcccacctggcc
atggagatgatctccgagtgcccgaatttgaagtcgttagaggtcgttgagctgaacccc
attcttgaccggcagaacgtcacgggtaagctcgccatcggtctgataagctcggccttc
gggaaaaagatcctatag

DBGET integrated database retrieval system