KEGG   Methanocella paludicola: MCP_2587Help
Entry
MCP_2587          CDS       T01142                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mpd  Methanocella paludicola
Pathway
mpd00220  Arginine biosynthesis
mpd00330  Arginine and proline metabolism
mpd01100  Metabolic pathways
mpd01110  Biosynthesis of secondary metabolites
mpd01130  Biosynthesis of antibiotics
mpd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MCP_2587 (rocF)
   00330 Arginine and proline metabolism
    MCP_2587 (rocF)
Enzymes [BR:mpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MCP_2587 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAI62659
NITE: MCP_2587
UniProt: D1Z1T7
Position
2544174..2545091
Genome map
AA seq 305 aa AA seqDB search
MSKKDDVIGKVRIVGVPLDLGADRRGIDMGPDALRNDGLVEALEKLGIDVQDTGNIMLPP
RPPKKKYDSRLKNYEEVIFACQRVRDFVGRSIADGYFPLVIGGDHSIAMGTTAALSTFYN
KIGIIWIDAHGDFNTEDTTISGNIHGMSFATSCGRGSKNLVGKLGVRTSVSEANCVLIGA
RDLDPLERELLKKSNVTVFTMRDIDEQGMHKIMKKALKIACDGTDALHVSFDIDVMDPME
APGVGTPVQGGMTYREAHLAMEMISECPNLKSLEVVELNPILDRQNVTGKLAIGLISSAF
GKKIL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaagacgacgtcatcggcaaggtccgcattgtaggcgttccactggacctg
ggcgcagacaggcggggcatcgacatgggccccgacgccctgcggaacgacgggcttgtc
gaggcgctggagaagctgggcatcgacgtgcaggatacgggcaacatcatgctgcccccg
cggcccccgaagaaaaaatacgattcccggctgaagaactacgaggaggtcatcttcgcc
tgccagcgcgtgagggacttcgtgggcaggagcatcgccgacgggtattttcctttagtg
atcggcggcgaccacagcatcgccatgggcacgaccgcggccctgagcaccttctataat
aagatcggcatcatctggatcgacgcccacggcgacttcaatacggaagatacgaccatc
agcggcaacatccacggcatgagcttcgccacgtcctgcggccggggctcgaagaacctg
gtcggcaagctgggcgtcaggacgagcgtctccgaggccaactgtgtcctcatcggcgcc
cgtgacctggatcctttagagcgggagctgctgaaaaagtcgaacgtgacggtctttacg
atgcgggacatcgacgagcagggcatgcacaagatcatgaagaaggccctgaagatcgcc
tgcgacggcacggatgcccttcacgtttccttcgacatcgacgtcatggaccccatggag
gcgcccggcgtgggcacgcccgtgcagggcgggatgacctatcgcgaggcccacctggcc
atggagatgatctccgagtgcccgaatttgaagtcgttagaggtcgttgagctgaacccc
attcttgaccggcagaacgtcacgggtaagctcgccatcggtctgataagctcggccttc
gggaaaaagatcctatag

DBGET integrated database retrieval system