KEGG   Methanocella paludicola: MCP_2612Help
Entry
MCP_2612          CDS       T01142                                 

Definition
pyruvate synthase delta chain
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mpd  Methanocella paludicola
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCP_2612
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCP_2612
   00020 Citrate cycle (TCA cycle)
    MCP_2612
   00620 Pyruvate metabolism
    MCP_2612
   00640 Propanoate metabolism
    MCP_2612
   00650 Butanoate metabolism
    MCP_2612
  Energy metabolism
   00680 Methane metabolism
    MCP_2612
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCP_2612
Enzymes [BR:mpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCP_2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2567392..2567676
Genome map
AA seq 94 aa AA seqDB search
MARKEKLTIGLVGKPGSTLTYHTGGWRTFRAVISHEKCIGCKRCADSCPDGAPYECAHDG
KKKKFCIDYDYCKGCGICAYECPVDAINMEKEEK
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaaagaaaagctaaccatcggcctcgtgggaaagcccggaagcacacttacg
tatcacacgggcggctggaggaccttcagggccgtaataagccacgagaagtgcatcggc
tgcaagcgctgtgccgattcctgccccgacggggcgccgtacgagtgcgcccacgacggc
aagaaaaagaagttctgtatcgattatgattattgtaagggctgcggcatctgcgcctac
gagtgccccgtggatgccatcaacatggaaaaggaggaaaagtaa

DBGET integrated database retrieval system