KEGG   Methanocella paludicola: MCP_2612Help
Entry
MCP_2612          CDS       T01142                                 

Definition
(GenBank) pyruvate synthase delta chain
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mpd  Methanocella paludicola
Pathway
mpd00010  Glycolysis / Gluconeogenesis
mpd00020  Citrate cycle (TCA cycle)
mpd00620  Pyruvate metabolism
mpd00640  Propanoate metabolism
mpd00650  Butanoate metabolism
mpd00680  Methane metabolism
mpd00720  Carbon fixation pathways in prokaryotes
mpd01100  Metabolic pathways
mpd01120  Microbial metabolism in diverse environments
mpd01130  Biosynthesis of antibiotics
mpd01200  Carbon metabolism
Module
mpd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCP_2612
   00020 Citrate cycle (TCA cycle)
    MCP_2612
   00620 Pyruvate metabolism
    MCP_2612
   00640 Propanoate metabolism
    MCP_2612
   00650 Butanoate metabolism
    MCP_2612
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCP_2612
   00680 Methane metabolism
    MCP_2612
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCP_2612
Enzymes [BR:mpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCP_2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_7 Fer4_6 Fer4_2 Fer4_16 Fer4_10 Fer4_9 Fer4_4 Fer4_22 Fer4_15 Fer4_17 Fer4_8 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-ProteinID: BAI62684
NITE: MCP_2612
UniProt: D1Z1W2
Position
2567392..2567676
Genome map
AA seq 94 aa AA seqDB search
MARKEKLTIGLVGKPGSTLTYHTGGWRTFRAVISHEKCIGCKRCADSCPDGAPYECAHDG
KKKKFCIDYDYCKGCGICAYECPVDAINMEKEEK
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaaagaaaagctaaccatcggcctcgtgggaaagcccggaagcacacttacg
tatcacacgggcggctggaggaccttcagggccgtaataagccacgagaagtgcatcggc
tgcaagcgctgtgccgattcctgccccgacggggcgccgtacgagtgcgcccacgacggc
aagaaaaagaagttctgtatcgattatgattattgtaagggctgcggcatctgcgcctac
gagtgccccgtggatgccatcaacatggaaaaggaggaaaagtaa

DBGET integrated database retrieval system