KEGG   Methanocella paludicola: MCP_2612Help
Entry
MCP_2612          CDS       T01142                                 

Definition
(RefSeq) pyruvate synthase delta chain
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mpd  Methanocella paludicola
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCP_2612
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCP_2612
   00020 Citrate cycle (TCA cycle)
    MCP_2612
   00620 Pyruvate metabolism
    MCP_2612
   00640 Propanoate metabolism
    MCP_2612
   00650 Butanoate metabolism
    MCP_2612
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCP_2612
   00680 Methane metabolism
    MCP_2612
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCP_2612
Enzymes [BR:mpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCP_2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2567392..2567676
Genome map
AA seq 94 aa AA seqDB search
MARKEKLTIGLVGKPGSTLTYHTGGWRTFRAVISHEKCIGCKRCADSCPDGAPYECAHDG
KKKKFCIDYDYCKGCGICAYECPVDAINMEKEEK
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaaagaaaagctaaccatcggcctcgtgggaaagcccggaagcacacttacg
tatcacacgggcggctggaggaccttcagggccgtaataagccacgagaagtgcatcggc
tgcaagcgctgtgccgattcctgccccgacggggcgccgtacgagtgcgcccacgacggc
aagaaaaagaagttctgtatcgattatgattattgtaagggctgcggcatctgcgcctac
gagtgccccgtggatgccatcaacatggaaaaggaggaaaagtaa

DBGET integrated database retrieval system