KEGG   Methanocella paludicola: MCP_2902Help
Entry
MCP_2902          CDS       T01142                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpd  Methanocella paludicola
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCP_2902 (tpiA)
   01230 Biosynthesis of amino acids
    MCP_2902 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCP_2902 (tpiA)
   00051 Fructose and mannose metabolism
    MCP_2902 (tpiA)
   00562 Inositol phosphate metabolism
    MCP_2902 (tpiA)
Enzymes [BR:mpd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MCP_2902 (tpiA)
Exosome [BR:mpd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MCP_2902 (tpiA)
  Exosomal proteins of bladder cancer cells
   MCP_2902 (tpiA)
  Exosomal proteins of melanoma cells
   MCP_2902 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2853815..2854471)
Genome map
AA seq 218 aa AA seqDB search
MQKPIIILNYKTYLESSGDKGRQLTWDARDVMQETGIRIIVCPQTPELFHHKGYGIEVFA
QHVDPIEPGSHTGHVLPQSLQFCGVTGSLINHSEDRRPLEEIKKCVEVLRKHGMTSVVCA
ESIEKVKEVSQFKPDYVAIEPPELIGSGIPVSKADPGIVRNSVKAVTDPNVKVLCGAGIS
KGEDVKAALELGTVGVLLASGVVKAKDPKAALRDLVTY
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagcccatcatcatcctcaattataagacctacctggagagctctggagataaa
ggccgccagctcacctgggacgcaagggacgtcatgcaggagaccggcatacgcatcatc
gtctgcccccagacgcccgagctattccatcacaaaggctatggcatagaggtctttgcg
cagcacgtcgaccccatcgagcccggcagccacacgggacacgtcctgccgcagtcgctc
cagttctgcggggtcaccggctcgctcatcaaccactctgaggaccgccggcccctggag
gagatcaagaagtgcgtcgaagtgctccggaagcacggcatgacctccgtcgtgtgtgcc
gagagcatcgagaaggtgaaggaggtctcgcagttcaagccggactacgtcgccatcgag
ccgccggagctcatcggcagcggcatccctgtgtcgaaggccgacccgggcatcgtgcgg
aactccgtaaaagcggtcaccgacccgaacgtgaaggtactgtgcggcgccggcatctcg
aagggcgaggacgtgaaggcggccctggagctgggcaccgtcggcgtgctgctggcctcg
ggtgtcgtgaaggcgaaggacccgaaggcggcgctgcgggacctggtcacctattaa

DBGET integrated database retrieval system