KEGG   Methanocella paludicola: MCP_2907Help
Entry
MCP_2907          CDS       T01142                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mpd  Methanocella paludicola
Pathway
mpd00260  Glycine, serine and threonine metabolism
mpd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mpd01100  Metabolic pathways
mpd01110  Biosynthesis of secondary metabolites
mpd01130  Biosynthesis of antibiotics
mpd01230  Biosynthesis of amino acids
Module
mpd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCP_2907 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCP_2907 (trpA)
Enzymes [BR:mpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCP_2907 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG
Motif
Other DBs
NCBI-ProteinID: BAI62979
NITE: MCP_2907
UniProt: D1Z2Q7
Position
complement(2858014..2858844)
Genome map
AA seq 276 aa AA seqDB search
MRLTEKFEELKKRGEGALIAYITLGDPSPEESFMLAQSLIDSGSVDVLELGVPFSDPIAD
GPVIQAAVDRALKAGMNTDLAFRLTGRLDKKVPVVYLTYYNIVLQRGVEKFARDCRDSGV
SGLIVADLPFEESGFLRRACRESGVDYIHIVTPNTPAARMRMILEDASGFVYLVSSMGVT
GARRDLAGGLAETVARAVECSNGTPVAVGFGISAPEHVRGVLNMGAEGAIVGSAIVGMAA
KGAGMAEVLKFVDGLKAGARAQATCCAPSTGPDITK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctcacggagaagttcgaggagttaaagaaaaggggagagggcgcgctcatcgca
tatattacgctgggcgacccgtcgcctgaagagtcgttcatgctggctcagtccctcatc
gactcgggcagcgtggacgtgctcgagcttggcgtcccgttctcggaccccatcgcggac
ggccccgtgatacaggccgccgtggacagggcgctgaaggcgggcatgaacacggacctg
gccttccgcttaacggggcggctcgacaaaaaagtgcccgtcgtgtacctcacgtactac
aacatcgtgctccagcgcggtgtagagaaattcgcaagggactgcagggattccggcgtg
agcgggctcatcgtggccgacctcccgttcgaggagagcggttttctacgtagagcctgc
agggagagcggcgtcgactacatccacatcgtcacgcccaacacgccagctgcccgcatg
cgcatgatactcgaggacgcctcgggattcgtttacctggtctccagcatgggcgtcacc
ggcgcgcggagggacctggcggggggcctggccgaaaccgtggcccgcgcggtcgagtgc
tcgaacggcacccccgtggccgtggggttcgggatctccgcgcccgagcacgtaaggggc
gtcctcaacatgggcgccgaaggcgccatcgtcgggagcgccatcgtgggcatggccgca
aaaggggccggaatggcagaggtcctgaagttcgtggacgggctgaaggccggcgcaagg
gcgcaggcgacctgttgcgctccttctaccggtcctgatataacgaagtga

DBGET integrated database retrieval system