KEGG   Methanocella paludicola: MCP_2923Help
Entry
MCP_2923          CDS       T01142                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mpd  Methanocella paludicola
Pathway
mpd00860  Porphyrin and chlorophyll metabolism
mpd01100  Metabolic pathways
mpd01110  Biosynthesis of secondary metabolites
mpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MCP_2923 (hemD)
Enzymes [BR:mpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MCP_2923 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: BAI62995
NITE: MCP_2923
UniProt: D1Z2S3
Position
complement(2876864..2877649)
Genome map
AA seq 261 aa AA seqDB search
MKRVALTKRVAVTRPAKFLPAAVEYLRSKGMEAVPVPMMEMVPRKNGDVDAFLERLSAGQ
VDVIILTSQNGFLFLLERLGDDVEHFLGLVEGVRVLAIGPKTKKALEAHAIWAKMVPSTY
SSEGIVKEFSFPRKHVEVLRSDHGNPVLIKGLEAGGAIVHETILYDIVPLKGEAQEAFVR
EALAGSIDAFTFTSTMTARSLFMTAESMGVLPELKSAMNAKAVAVIGTPTAEFLRENGVR
VDVVPRNFTFEEMIDDLAKAL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggtggccctgacaaagcgggtggccgtcacccgccccgcgaagttcctcccg
gcggcggtcgagtacctccggtcgaagggcatggaggccgtgccagtgcccatgatggag
atggtccccaggaagaacggggacgtcgatgccttcctggagcggctgagcgccggccag
gtggacgtaataatactgacaagccagaacggctttttatttcttctggagcggcttggc
gatgatgtcgagcactttttaggcctcgtcgagggcgtgcgcgtgctcgccatcggcccg
aagacgaagaaggcgctggaggcccacgccatctgggcgaagatggtcccgtccacctat
tcgagcgagggcatcgtcaaagagttctccttccccaggaagcacgtggaagtcctcagg
agcgaccacggcaaccccgtactgatcaaggggctggaggcaggcggggccatcgtgcac
gagaccatcctgtacgacatcgtgcctctgaagggcgaggcgcaggaggccttcgtccgg
gaggcccttgcgggcagcatcgacgccttcacattcaccagcaccatgacggcgaggagc
cttttcatgacggccgagtccatgggcgtcctgccggagcttaaatccgcgatgaatgct
aaggccgtggctgtcatcggcaccccgactgccgaattcttaagagagaacggcgttcgc
gtcgacgtggtgccccgtaacttcaccttcgaggaaatgatcgacgacctggcaaaggcg
ctttaa

DBGET integrated database retrieval system