KEGG   Methanocella paludicola: MCP_3000Help
Entry
MCP_3000          CDS       T01142                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mpd  Methanocella paludicola
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mpd00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mpd00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2953616..2954545
Genome map
AA seq 309 aa AA seqDB search
MIFGRRHIISTKDFSREEIDFILDRAERLEPYARKGGLDLLKDKVVATLFFEPSTRTRLS
FDTAIKRLGGDTIGFDSAESTSVVKGETLSDTIRIIESYADAIVIRHPREGAARMASEVS
SVPVINAGDGAGHHPTQTLLDLYTMRKECRKPLGDLNVAIVGDLRYGRTVHSLAYALSLY
GASLSLVSPEPLRMPESIINYLRKHGVTLVETPRIEDALGQADVLYMTRIQKERFPDPSE
YLRVAGSYRITPDTLESVGNDMIIMHPLPRVNEIDPGVDSTRHARYFQQAFYGVPIRMAV
LSLVMGKEI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgattttcgggagaaggcacatcatatccaccaaggacttctcaagagaagagatcgac
tttattctcgaccgcgccgagaggctggagccttacgcccgaaagggcggcctggacctg
ctaaaggataaggtggtggccacgctctttttcgagccctccacccggaccaggctgtcg
ttcgatacggcgattaagcgccttggcggcgataccatcggcttcgactccgcggagtcc
acgtccgtggtcaagggagagacgctgtccgataccatacgcatcatcgagtcgtacgcg
gacgccatcgtcatccgccaccccagggagggcgcggcacgcatggcctcagaggtgtcg
agcgtgcccgtgatcaatgccggggacggcgccggacatcaccccacccagacgctcctg
gacctctacaccatgcggaaagagtgcaggaagccgctgggcgatctgaacgtcgccatc
gtgggcgacctcaggtacgggcggaccgtgcactcgctggcgtacgcgctgtcgctctac
ggggcgagtctgagcctcgtgtccccggagcccctgcgcatgcccgagagcataataaac
tatttgaggaaacatggcgtcacgctggtcgagacgccccgcatcgaggacgccctgggg
caggcggacgtgctgtacatgacccgcatccagaaggagcggttccccgacccctcggaa
tatctgagggtcgccggctcgtaccgcatcacgcccgacacgctggagagcgtcggtaac
gacatgatcatcatgcacccgctgccgcgggtgaacgagatcgacccgggagtcgactcc
accaggcacgcccggtatttccagcaggccttctacggagtgcccatccggatggccgtg
ctgtccctggtgatgggcaaggagatctaa

DBGET integrated database retrieval system