KEGG   Mycoplasma penetrans: MYPE10380Help
Entry
MYPE10380         CDS       T00107                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mpe  Mycoplasma penetrans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MYPE10380
Enzymes [BR:mpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MYPE10380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(1355211..1355996)
Genome map
AA seq 261 aa AA seqDB search
MISMIYKSYPKINLFLSIGKKNKKNNLHKLNSVFLLVENSVYDEIKINLNEKEEDEISYF
DSTNKTLIIENCIFKKTISYLKEKEIIDKNLFFKIKIKKNIPLFSGLGSGSSNVACLFKF
LLEIKQINYFQIKKHILNIGSDVLFFIKNYKAAFVYKYGNKVKKVKNPNLKIKLFFTNIE
CSTKKVFEDYETNQSMCKNSYLKQFLYFKIKRYWMLENDLKESVFNLYKDLSIKHETLQK
KYDKKIFLTGSGGTLFLIEDK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgatttctatgatttataaaagttatccaaaaattaatttatttttatctattggtaaa
aaaaataaaaagaataatcttcataagttaaatagtgtttttttactggttgaaaactct
gtatatgatgaaataaaaattaatttaaatgaaaaagaagaagatgaaatttcttatttt
gattcaacaaataaaactttaataatagaaaactgcatctttaaaaaaacaattagttat
ttaaaagaaaaagaaattattgataaaaatttatttttcaaaataaaaattaaaaaaaac
atccctttattttctggacttggaagtggttcttctaatgttgcttgtttatttaaattc
ttattagaaataaaacaaattaactattttcaaattaaaaaacatattttaaacattggt
agtgatgttttattttttattaaaaactataaagcagcttttgtttataagtatggaaat
aaagttaaaaaagtaaaaaatcctaatttaaaaattaagttattttttacaaatattgaa
tgtagtactaaaaaagtttttgaagactatgaaactaaccaaagtatgtgtaaaaatagt
tatctaaaacaatttttgtattttaaaattaaaagatattgaatgttagaaaatgattta
aaagaaagtgtctttaatttatataaagacctttctataaaacatgaaacattacaaaaa
aaatatgataaaaaaatatttttaacaggatcaggaggaacacttttcttaatagaggat
aaataa

DBGET integrated database retrieval system