KEGG   Mycoplasma penetrans: MYPE1050Help
Entry
MYPE1050          CDS       T00107                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mpe  Mycoplasma penetrans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MYPE1050
Enzymes [BR:mpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MYPE1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
130032..131333
Genome map
AA seq 433 aa AA seqDB search
MNILDLIEKKKKNKKITEAEFNYFIDALINQEIKDYQTTAFMMAIYFNKLDFNETYYLTK
AIINSGKTFEWPSNIKNLIDKHSTGGVGDKVSLILLPLLSSLNVNIAKISGRGLGYTGGT
IDKLDSINMNTDLSEQEVFQILKENHFFVLQQTNEIVPADKILYALRDTSGTVDNLSLIA
SSIMSKKLALNTENIYLDVKVGDGAFFANLKDAKEFGALCIKLGKKFKKNVVVHYTDMNK
PLGRCLGNLIEVKEAVNFLNGIYECEYLKELIFEFAKDVLVDLKIAKNSKEAISMIEDAI
NSKKAIDSFIRWNKFQKGELDSIDKLTDFYNPLHKKEIYAESNGYLEFKSNKELGLILVD
LKAGRKAKTDTLDFEAGLYLNKYTGEQVKKGDVIVTIYSSSPIEDNVVQKLTNNIKINKE
KMKLNKTILGVSR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaacattttagatttaattgaaaaaaagaaaaaaaataaaaaaataactgaagctgaa
tttaattattttatagatgcactaattaatcaagaaatcaaagactatcaaactactgct
tttatgatggctatttattttaataagttagactttaatgaaacttattatcttactaaa
gcaattatcaatagtggaaaaacttttgaatgaccaagtaatattaaaaatttaattgat
aaacattcaactggtggagtgggggacaaagttagtttaatattgttgccactactaagt
tctttaaatgtaaatattgcaaaaatctcaggaagaggtttaggttatactggtggaaca
attgataagttggattcaattaatatgaatacagatttaagtgaacaagaagtttttcaa
attttaaaagagaatcatttttttgttttacaacaaactaatgaaattgttccagctgat
aaaattttatatgctttaagagatacttcaggaacagttgataacttgtctttaattgct
tcttctattatgtctaaaaaattagccttaaatactgaaaatatttatttggatgttaag
gttggagatggtgctttttttgctaatttaaaagatgcaaaagagtttggagcattatgt
attaaactaggtaagaagtttaaaaagaatgttgttgttcactatacagatatgaataaa
cctcttggaagatgtttaggtaatttgattgaagttaaagaagctgtaaactttctaaat
ggaatttatgaatgtgaatatttaaaagaattaatttttgaatttgcaaaagatgtttta
gtagatttaaaaattgctaaaaatagtaaagaagctatatcaatgatagaagatgctatt
aatagtaaaaaggcaattgactctttcattagatgaaacaagtttcaaaaaggtgaattg
gattcaattgataaattaacagatttttataaccctctacacaaaaaagaaatatatgct
gaatctaatggttatttagaatttaaatctaacaaagaattaggattaattttagtagat
ttaaaagccggaagaaaagcaaaaactgatacattagattttgaagcaggtttatattta
aacaaatatactggagaacaagttaaaaaaggtgatgtaatagttacaatttattcttct
tctccaattgaagataatgtagttcaaaaacttactaacaacattaaaatcaataaagaa
aagatgaaattaaataaaacaattttaggtgttagcagatag

DBGET integrated database retrieval system