KEGG   Mycoplasma penetrans: MYPE160Help
Entry
MYPE160           CDS       T00107                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpe  Mycoplasma penetrans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MYPE160
   00052 Galactose metabolism
    MYPE160
   00500 Starch and sucrose metabolism
    MYPE160
   00520 Amino sugar and nucleotide sugar metabolism
    MYPE160
Enzymes [BR:mpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MYPE160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
18805..19704
Genome map
AA seq 299 aa AA seqDB search
MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQ
YKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKR
FIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDP
LEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITG
SLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagagttacaaaagcagtaattccagcagctggaatgggaacaaggttttta
ccagctactaaagctatgcctaaagaaatgcttccaattctagataagcctactattcaa
tttatagtagaagaagcagtggcatctgggattgaagatattttaattattgtttcacaa
tataaaaattcaattatggatcactttgattatttttttgaattagaagaaagactaaag
caaaaaaataaagtagaagattacaaattagtaagaaatattagtgatatggcacatatt
cactatattagacaaaaagaaccaatgggattaggacatgctattaatatggctaaaagg
tttataggtaatgaaccttttgccatattattaggagatgatgttattgttcaaaataac
caatcagacaaacctgcattaaaacaatgtattgagttatttgaagaaaaaaatgtttct
attgtaggtgttcaagaagttgaacataaagaggttagtaaatatgggattatagaccca
ttagaacaagtagatctaaaaactcaatctatgagagtaaaaaatatgattgaaaaacca
gatcctagtattagtccaagtaattatgcaattttaggaagatatgttctaactccttct
atttttaaggagttagaagaaactcaagttagtcctagaggagaaatagaaattacagga
tcattattaaatttagcccaaaaagaaggagtatatgcgaaagtgtttactggtaaaaga
tatgacattggttctaaaattggttatttaaaagcaactttagatatttctttatctaaa
ccagatgttagagatgaattactagaatatatgaaattattagtagaaactaacaaataa

DBGET integrated database retrieval system