KEGG   Mycoplasma penetrans: MYPE2790Help
Entry
MYPE2790          CDS       T00107                                 

Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpe  Mycoplasma penetrans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mpe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(366346..367005)
Genome map
AA seq 219 aa AA seqDB search
MIEYIIGKISYKNNNYLILENNFKGYKLFMSDPNIFEENSSAKIFVYTKIFQNNKNNFLF
EYYGFKTLREKIFFENLLTVNGIGPKTSLTILRNDLNLLKELIRNEDIESLSVLEGFTNK
TALSIVSALSYKLKNERISEYNNDVNHSSINQQSNSYNPVPDLVSALKALGYKKNMIEKA
INLLIPQLSNVSEDQISDLISQAIKIISDEAVTNKTTVS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatacataattggtaaaatctcatacaaaaacaataattatttaattttagaa
aataactttaaaggttataaattgtttatgagtgatccaaacatatttgaagagaattct
tcagctaaaatctttgtttatacaaaaatatttcaaaacaataaaaataattttttattt
gaatactatgggttcaaaaccttaagggaaaaaattttctttgaaaatttattaactgta
aatggaattggaccaaaaactagtttaaccattttaaggaatgatttaaacttgttaaaa
gaattaatcagaaatgaagacattgaatctttatcagtactggaaggatttacaaataaa
acagcattatcaattgtcagtgctttatcttataaattaaaaaatgaaagaataagtgag
tataacaatgatgtaaatcatagtagtataaatcagcaaagtaattcatacaaccctgtt
ccagatttagtatctgctttaaaagcacttggttataagaagaatatgatagaaaaagct
attaatttattaattccacaattatcaaatgttagtgaagatcagattagtgatttaata
tcacaagcaattaaaataatttctgatgaagctgttacaaataagaccacagtatcttaa

DBGET integrated database retrieval system