KEGG   Mycoplasma penetrans: MYPE2790Help
Entry
MYPE2790          CDS       T00107                                 

Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpe  Mycoplasma penetrans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MYPE2790
Enzymes [BR:mpe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MYPE2790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(366346..367005)
Genome map
AA seq 219 aa AA seqDB search
MIEYIIGKISYKNNNYLILENNFKGYKLFMSDPNIFEENSSAKIFVYTKIFQNNKNNFLF
EYYGFKTLREKIFFENLLTVNGIGPKTSLTILRNDLNLLKELIRNEDIESLSVLEGFTNK
TALSIVSALSYKLKNERISEYNNDVNHSSINQQSNSYNPVPDLVSALKALGYKKNMIEKA
INLLIPQLSNVSEDQISDLISQAIKIISDEAVTNKTTVS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatacataattggtaaaatctcatacaaaaacaataattatttaattttagaa
aataactttaaaggttataaattgtttatgagtgatccaaacatatttgaagagaattct
tcagctaaaatctttgtttatacaaaaatatttcaaaacaataaaaataattttttattt
gaatactatgggttcaaaaccttaagggaaaaaattttctttgaaaatttattaactgta
aatggaattggaccaaaaactagtttaaccattttaaggaatgatttaaacttgttaaaa
gaattaatcagaaatgaagacattgaatctttatcagtactggaaggatttacaaataaa
acagcattatcaattgtcagtgctttatcttataaattaaaaaatgaaagaataagtgag
tataacaatgatgtaaatcatagtagtataaatcagcaaagtaattcatacaaccctgtt
ccagatttagtatctgctttaaaagcacttggttataagaagaatatgatagaaaaagct
attaatttattaattccacaattatcaaatgttagtgaagatcagattagtgatttaata
tcacaagcaattaaaataatttctgatgaagctgttacaaataagaccacagtatcttaa

DBGET integrated database retrieval system