KEGG   Mycoplasma penetrans: MYPE3730Help
Entry
MYPE3730          CDS       T00107                                 

Definition
triose phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpe  Mycoplasma penetrans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYPE3730
   01230 Biosynthesis of amino acids
    MYPE3730
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYPE3730
   00051 Fructose and mannose metabolism
    MYPE3730
   00562 Inositol phosphate metabolism
    MYPE3730
Enzymes [BR:mpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MYPE3730
Exosome [BR:mpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MYPE3730
  Exosomal proteins of bladder cancer cells
   MYPE3730
  Exosomal proteins of melanoma cells
   MYPE3730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
482025..482777
Genome map
AA seq 250 aa AA seqDB search
MKKLIIANWKMFKTLNDIKTFKEEFDKNIKNVKVNADYSVGVPSIYLNQAKEILKGIKVI
AQDAHFKNEGAYTGNISWSQLKDCGIDGSIIGHSERRQMFNETDETVNLKTISLVENNMQ
AVVCVGETLEEYEANKSFDVVWNQTKKALANVSEAQLKNVVIAYEPVWAIGTGKVPTGKE
VDDLIQKVRDELSKLYSKQAVESLVVLYGGSVNDKNAEEFFKQKNINGALVGSFCLKAEN
FVKLIELGGN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctaatcatagcaaattgaaaaatgtttaaaacattaaatgatataaaaaca
ttcaaagaagaatttgataaaaatataaaaaatgtaaaagttaatgctgattatagtgtt
ggtgttccaagcatttacttaaaccaagcaaaagaaattttaaaaggaattaaagtaatt
gctcaagatgcacactttaaaaatgaaggagcatacactggaaacatttcttgatctcaa
ttaaaagattgtggaattgatggttcaattattggacactctgaaagaagacaaatgttt
aatgaaactgatgaaactgtaaatttaaaaactatttcattagtagaaaataatatgcaa
gctgtagtttgtgttggtgaaactttagaagaatatgaagctaacaaatcttttgatgtt
gtatgaaaccaaactaaaaaagctttagcaaatgtaagtgaagcacaattaaaaaatgtt
gtaattgcgtatgaaccagtttgagcaatcggaactggaaaagtaccaactggaaaagaa
gtagatgatttaattcaaaaggtaagagatgaattaagcaaactatatagcaaacaagct
gttgaatcattagtggttctatatggtggttcagtaaatgataaaaatgcagaagagttt
tttaaacaaaaaaacattaatggtgcattagtaggaagcttttgtttaaaagcagaaaac
tttgttaaattaattgaattaggtggaaactaa

DBGET integrated database retrieval system