KEGG   Mycoplasma penetrans: MYPE4550Help
Entry
MYPE4550          CDS       T00107                                 

Definition
beta glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
mpe  Mycoplasma penetrans
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYPE4550
Enzymes [BR:mpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     MYPE4550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
592078..593508
Genome map
AA seq 476 aa AA seqDB search
MKFKKLEKFPEGFLWGASSSAYQIEGAWDEDGKGMSTQDLPKQNVDGWVDWSKITDFKVA
SDQYHRYKEDIALMAEMGFKAYRFSIAWTRIIPDGNGAINKKGIQHYHDVIDELLKHGIE
PVITMYHFDLPLALEQQGGWTNRDLIVPAFVKYAKVLFKEYGHKVKYWLTINEQNMVAMV
GDILGMVSSDPKNRWKHMANLNHNMLLAQSYAFIYLHKMCPNAKIGPAPNICVYYPKSCN
PEDFTAAKNAQSLLHWYYLDIAVRGKYNNIVWKFLKDNDALPEIRKDDFKVFKAGKPDFI
AFNYYASGTAEKDEGDAVITHGDQHSMFDVPGLYKGAENEYLGKTNYGWAKDPIGFRNTF
RELYDRYQLPLLVTENGLGTQDTLTADEKIHDDYRIEYLENHIKEMRNAISDGVEILGYC
PWSAVDLVSTHQGITKRYGFVYVNRDEFDLKDLRRIRKDSFYWYQNVIKNNGNNIE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaaaaattagaaaaattccctgaagggtttttatgaggggcatcatctagt
gcttatcaaattgaaggtgcttgagatgaagatggaaaaggtatgtctacccaagactta
ccaaagcaaaatgttgatggatgagtagattgatcaaagattactgattttaaagtagca
agtgatcaataccatagatataaagaagatattgctttaatggcagaaatgggatttaaa
gcatatcggttctcaattgcatgaactagaatcattcctgatggtaatggtgctattaat
aaaaaaggaattcaacactaccatgatgtaattgatgaattattaaaacatggaattgaa
ccagttattacaatgtatcactttgatttaccattggctttagaacaacaaggtggatga
acaaatcgtgatttaatagttccagcatttgtaaaatatgctaaagtactatttaaagaa
tatggacataaagtaaaatactgattgactatcaatgaacaaaacatggtagcaatggtt
ggtgatattttaggaatggtttcatcagatccaaaaaacagatgaaaacacatggctaat
ttaaatcacaatatgttactagctcaatcttatgcttttatttatttacataaaatgtgt
cctaatgctaagattggacctgctccaaatatttgtgtatactatccaaaaagttgtaat
ccagaagattttactgcagctaaaaatgcccaatcattactacattgatactatttagat
attgcagtaagaggcaaatataacaatatagtttgaaagttcttaaaagacaatgatgca
ttaccagaaattagaaaagatgactttaaagtttttaaagcaggtaaacctgactttatt
gcttttaactactatgcatcaggaactgcagaaaaagatgaaggagatgcagttatcaca
catggtgatcaacactctatgtttgatgtaccaggtttatataaaggtgcagaaaatgaa
tatttaggtaaaacaaattatggttgagcaaaagaccctattggttttagaaatacattt
agagaattatatgatcgttatcaattacctttattagttactgaaaatgggttaggaact
caagatacactaacagcagatgaaaagattcatgatgattatcggattgaatatttagaa
aaccatattaaagaaatgagaaatgctattagtgatggtgtagaaattttaggatactgt
ccatgaagtgcagttgatcttgtgtctactcaccaaggtattactaaacgttatggtttt
gtatatgttaatcgtgatgaatttgatcttaaagatttaagaagaattagaaaagacagt
ttctattgataccaaaatgtaattaaaaataatggtaacaatattgaataa

DBGET integrated database retrieval system