KEGG   Mycoplasma penetrans: MYPE5640Help
Entry
MYPE5640          CDS       T00107                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mpe  Mycoplasma penetrans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MYPE5640
Enzymes [BR:mpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MYPE5640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(718527..719117)
Genome map
AA seq 196 aa AA seqDB search
MEEKNKKGKIIIISGPSGVGKKTIIDQVINNVDLNLTYSISMTTRLPREHEKNGVDYFFV
SEEEFNSAIEKGELLEWAEFANNKYGTPIKNLYKLIGENKNVILEIEVQGATKVKDILNR
EDYISIFLIPPSIRELKRRLKIRDTETKEKIKQRIKRAKVELKLQNEYDFIILNDDAKNA
ADKLRHILYEKVLEKK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaaataaaaaaggaaaaataattattattagtggtccaagtggggttgga
aaaaaaacaataattgatcaagttattaataatgttgatcttaatttaacatatagtatt
tcaatgactaccaggcttccaagagaacatgaaaaaaatggtgtagattatttctttgtc
tctgaagaagaatttaatagtgcaattgaaaaaggtgagttattagaatgagcagaattt
gcaaacaataaatatggaacaccaattaaaaatttatataagttaattggtgaaaataaa
aatgtaatcttagaaatcgaggttcaaggtgcaaccaaggttaaagacattttaaacaga
gaagattatatttctatttttttgataccaccatcaatcagggaattaaaaagaagattg
aaaattagagatactgaaactaaagaaaaaattaaacaaagaattaaaagagctaaagtt
gaattaaaattacaaaatgaatatgactttatcatcttgaatgatgatgctaaaaatgca
gcagataaattaagacatatcctttatgaaaaggtactagaaaagaaataa

DBGET integrated database retrieval system