KEGG   Mycoplasma penetrans: MYPE5920Help
Entry
MYPE5920          CDS       T00107                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpe  Mycoplasma penetrans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYPE5920 (pfkA)
   01230 Biosynthesis of amino acids
    MYPE5920 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYPE5920 (pfkA)
   00030 Pentose phosphate pathway
    MYPE5920 (pfkA)
   00051 Fructose and mannose metabolism
    MYPE5920 (pfkA)
   00052 Galactose metabolism
    MYPE5920 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MYPE5920 (pfkA)
Enzymes [BR:mpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MYPE5920 (pfkA)
Protein phosphatases and associated proteins [BR:mpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MYPE5920 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(750031..750999)
Genome map
AA seq 322 aa AA seqDB search
MKKIAILTSGGDASTMNKCLSTFITYASKYNCEVVFVKNGYKGIYDNEFVKPDYTETKSW
WSLPGTKIYSSRFPEILDEQVRKQMVDNLHKNSIDTLVVIGGDGSYKGARLLSKSGIKVI
GLPGTIDNDIASTSYSIGFDTSLNAIVNSIKEIKSCMDSHANVAMIEIMGRHCIDLTVFA
GIATEADIIITPESFYTPQQLLAKINEKRKTNSRGIIILYVELLLGTENIPTVEEYIKYI
QANSKESVKKNILGYLQRGGNPTAMDMIRASLMTEHALKMISENQYNKIIGVDEFKVVSY
DLETAINMKNPSRKDLIDKFFN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcgcaatattaacatctggtggtgatgcatcaactatgaataaatgtctt
agtacatttattacatatgctagtaaatacaattgtgaagttgtatttgtaaaaaatggt
tataaaggaatttacgataatgaatttgttaaaccggattatactgaaactaaatcttga
tgaagtttaccaggaacaaaaatctattcttctagatttccagaaatcttagatgaacaa
gttagaaaacaaatggttgataacttacataaaaattcgattgatacattagttgtcatt
ggaggagatggaagttataaaggagctagattattatctaaatcaggaattaaggttatt
ggtttaccaggaacaattgataatgatatagcttcaacaagttattcaattggttttgat
acatcattaaatgcaattgttaattcaattaaagaaattaaatcatgtatggattctcat
gcaaatgttgcaatgattgaaatcatgggaagacattgtattgatttaactgtatttgct
ggaattgcaactgaagctgatatcataattactcctgaaagtttttatacaccacaacaa
ctattagctaagataaatgaaaaaagaaaaactaattctagaggaattataattctttat
gttgaactattattaggtactgaaaatattccaacagttgaagaatacattaaatatatt
caagcaaattcaaaagaatcagttaagaaaaatattttaggatatttacaacgtggtggg
aatccaactgcaatggatatgataagagcaagtttaatgactgaacatgctttaaaaatg
attagtgaaaaccaatataacaaaattattggtgttgatgaatttaaagtagtaagttat
gatttagaaactgctatcaatatgaaaaacccaagcagaaaagatttaattgataaattc
tttaactaa

DBGET integrated database retrieval system