KEGG   Mycoplasma penetrans: MYPE6860Help
Entry
MYPE6860          CDS       T00107                                 

Definition
dihyrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mpe  Mycoplasma penetrans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYPE6860
   00670 One carbon pool by folate
    MYPE6860
Enzymes [BR:mpe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MYPE6860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(882695..883159)
Genome map
AA seq 154 aa AA seqDB search
MFISIWCEDKNRGIGKNNKLPWNIKEDLNLFKKHTLNNTIVMGKNTFLSIGKALPNRKNI
VISKTLDASLYKDIEVYDDIEQFYNEYKNRDESIFIIGGKSIYDYFINKCSILYVSKLNS
AYECDLFMDNSFDGFEIVNQKEYEQFTFFEYRKV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtttatttctatttgatgtgaagataaaaatagaggaataggtaaaaacaataaatta
ccttgaaacattaaagaggatttaaatctatttaaaaaacatactttaaataacactata
gtaatggggaaaaacactttcttatcaattggtaaagctttaccaaatagaaaaaatatt
gttatttctaaaacattagatgcatccttatataaggatatagaagtatatgatgatatt
gaacaattctataatgaatataaaaatagagatgaatcaatatttattattggtggtaaa
agtatctatgattattttattaacaaatgttcaatactatatgtatctaaactaaattca
gcatatgaatgtgatttatttatggataatagctttgatggttttgaaatagtaaaccaa
aaagaatatgaacaatttacattttttgaatatagaaaagtttaa

DBGET integrated database retrieval system