KEGG   Mycoplasma penetrans: MYPE6860Help
Entry
MYPE6860          CDS       T00107                                 

Definition
dihyrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mpe  Mycoplasma penetrans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mpe00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mpe00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(882695..883159)
Genome map
AA seq 154 aa AA seqDB search
MFISIWCEDKNRGIGKNNKLPWNIKEDLNLFKKHTLNNTIVMGKNTFLSIGKALPNRKNI
VISKTLDASLYKDIEVYDDIEQFYNEYKNRDESIFIIGGKSIYDYFINKCSILYVSKLNS
AYECDLFMDNSFDGFEIVNQKEYEQFTFFEYRKV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtttatttctatttgatgtgaagataaaaatagaggaataggtaaaaacaataaatta
ccttgaaacattaaagaggatttaaatctatttaaaaaacatactttaaataacactata
gtaatggggaaaaacactttcttatcaattggtaaagctttaccaaatagaaaaaatatt
gttatttctaaaacattagatgcatccttatataaggatatagaagtatatgatgatatt
gaacaattctataatgaatataaaaatagagatgaatcaatatttattattggtggtaaa
agtatctatgattattttattaacaaatgttcaatactatatgtatctaaactaaattca
gcatatgaatgtgatttatttatggataatagctttgatggttttgaaatagtaaaccaa
aaagaatatgaacaatttacattttttgaatatagaaaagtttaa

DBGET integrated database retrieval system