KEGG   Mycoplasma penetrans: MYPE7890Help
Entry
MYPE7890          CDS       T00107                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mpe  Mycoplasma penetrans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mpe00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mpe00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(1057556..1058458)
Genome map
AA seq 300 aa AA seqDB search
MALYELTNLLSIDDLTNEQILNLIKRAIDIKENNNQIKRDDLYVANLFFENSTRTKMSFV
VAQNKLGLKSIDFEVSTSSVNKGETLYDTCKTLEMIGVNMLVIRHSQKQYYKELENLEIP
IINGGDGSGEHPTQCLLDLMTIYEKFKSFEGLKIAIVGDIKNSRVAKSNYKALTKLGAIV
HFVAPDKFKDDEFNNYKEFDEIINEIDVCMLLRVQHERHESQDKTQEFINIYHQQHGLSL
PRYNKLKENAIVMHPAPVNRGVEIDTTLVESDKSVIFLQMKNGMFMRQAVLEYIIAENNL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctttatatgaattaacaaatttactatcaattgatgatttaacaaatgaacaaatt
ttaaatcttattaaaagagcaattgatatcaaagaaaataacaatcaaattaaaagagat
gatttatatgtagctaatttattttttgaaaactcaacaagaaccaaaatgagttttgtt
gtagcacaaaataaactaggcttaaaatcaatagattttgaagtttcaacttcttcagtt
aataaaggtgaaactttatatgatacttgtaaaacattagaaatgattggtgttaatatg
ttggttattagacatagtcaaaaacaatactataaagagttagaaaacttagaaatacca
attattaatggtggtgatggaagtggtgaacacccaacacaatgtctattagatttaatg
acaatttatgaaaagtttaaatcatttgaagggttaaaaatagcaattgttggagatatt
aaaaattctagagttgctaaaagtaactataaagctttaacaaaattaggagcaattgta
cattttgtagccccagataaattcaaagatgatgaatttaacaattataaagagtttgat
gaaatcataaatgaaatagatgtttgtatgttactaagagtacaacatgaaagacacgag
agccaagacaaaacccaagaatttataaatatctatcatcaacaacatggactttcacta
cctcgttataacaaactaaaagaaaatgctattgtaatgcatccagcaccagtaaacaga
ggagttgaaattgatacaacattagtagaatctgataaatctgtaatctttttacaaatg
aaaaatggaatgtttatgagacaagcagttttagaatatatcattgcagagaataactta
tag

DBGET integrated database retrieval system