KEGG   Mycoplasma penetrans: MYPE8060Help
Entry
MYPE8060          CDS       T00107                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mpe  Mycoplasma penetrans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MYPE8060 (recR)
DNA repair and recombination proteins [BR:mpe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MYPE8060 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(1083834..1084439)
Genome map
AA seq 201 aa AA seqDB search
MKPKEFEYFVEALKSLPTISNKNASKIAYFFLEADEVFYSQFLDRLTSLKSNIKFCLNCN
NLTSDSLYCDICNTDSRDKNKLCIVSYLEDLEKIEASNSFSGLYFVLNTEIKHKDLKTAK
KINLEKLENMINKFHVREILICTNMTIDGELTSSYIKNFIKEKNYNIDLYRLALGIPMNA
SIEYIDWESLKYSIENKRKID
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaaaagaatttgaatattttgtagaagcactaaaaagtttacctactatttca
aataaaaatgcttcaaaaattgcttatttctttttagaagcagatgaagttttttatagt
caatttttagatagactaactagtttgaaatcaaatattaaattttgtttaaattgtaat
aatctaacttctgattctctatactgtgatatttgtaatactgatagcagggataaaaat
aaattatgtattgtttcatatttagaagacttagaaaaaattgaagcttctaatagtttt
agtggattgtattttgttttaaatacagaaataaaacataaggatttaaaaactgctaaa
aaaataaatttagagaagttagaaaacatgattaataaattccatgtgagagaaattctg
atttgtactaacatgacaattgatggtgaattaacttcttcttacattaaaaattttatt
aaagaaaaaaactacaatattgatttatatcggttagcattaggtattccaatgaatgct
tcaattgaatatattgattgagaatcattaaaatactcaattgaaaacaaaagaaaaatt
gactaa

DBGET integrated database retrieval system