KEGG   Mycoplasma penetrans: MYPE8060Help
Entry
MYPE8060          CDS       T00107                                 

Gene name
MYPE8060
Definition
(GenBank) recombinational DNA repair protein RecR
  KO
K06187  
recombination protein RecR
Organism
mpe  Mycoplasma penetrans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MYPE8060 (MYPE8060)
DNA repair and recombination proteins [BR:mpe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     MYPE8060 (MYPE8060)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MYPE8060 (MYPE8060)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NIH_Japan: 
UniProt: 
Position
complement(1083834..1084439)
Genome map
AA seq 201 aa AA seqDB search
MKPKEFEYFVEALKSLPTISNKNASKIAYFFLEADEVFYSQFLDRLTSLKSNIKFCLNCN
NLTSDSLYCDICNTDSRDKNKLCIVSYLEDLEKIEASNSFSGLYFVLNTEIKHKDLKTAK
KINLEKLENMINKFHVREILICTNMTIDGELTSSYIKNFIKEKNYNIDLYRLALGIPMNA
SIEYIDWESLKYSIENKRKID
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaaaagaatttgaatattttgtagaagcactaaaaagtttacctactatttca
aataaaaatgcttcaaaaattgcttatttctttttagaagcagatgaagttttttatagt
caatttttagatagactaactagtttgaaatcaaatattaaattttgtttaaattgtaat
aatctaacttctgattctctatactgtgatatttgtaatactgatagcagggataaaaat
aaattatgtattgtttcatatttagaagacttagaaaaaattgaagcttctaatagtttt
agtggattgtattttgttttaaatacagaaataaaacataaggatttaaaaactgctaaa
aaaataaatttagagaagttagaaaacatgattaataaattccatgtgagagaaattctg
atttgtactaacatgacaattgatggtgaattaacttcttcttacattaaaaattttatt
aaagaaaaaaactacaatattgatttatatcggttagcattaggtattccaatgaatgct
tcaattgaatatattgattgagaatcattaaaatactcaattgaaaacaaaagaaaaatt
gactaa

DBGET integrated database retrieval system