KEGG   Mycoplasma putrefaciens KS1: MPUT_0008Help
Entry
MPUT_0008         CDS       T01599                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
mpf  Mycoplasma putrefaciens KS1
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:mpf00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MPUT_0008 (pfkB)
Enzymes [BR:mpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     MPUT_0008 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(11344..12294)
Genome map
AA seq 316 aa AA seqDB search
MIYTITLNPAIDYTIETNGFSLNETNYYDNAYSLIGGKGINVAFVLNNLKNNVLATGFLG
DENFEKFNKKFKELKLKNNFFLYPGNTRTNFKIKDLSNNLEVELNGYGQKIDKNYVNKLM
NYLKNNLTKNDIVVVSGSIPKNLDSKIYQELGQVINQKQALFILDSSKSALLNGLKSKPY
LIKPNIGELCAIFEKQVKDYDFIEIQKMILKLRRLGARNILLSMGSNGSYFFSEDNSIYK
IGIGKGKLINSVGAGDSMLAGFVHGIENNLSLIETLKYASACGSATAFNKWLATSKDIKK
QIIEIEIWKIEEGLCK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacaataactttaaatccagcaattgactatactatagaaactaatggtttt
agtctaaacgaaactaactattatgataatgcttattcactgattggaggcaaaggaatc
aatgttgcgtttgttcttaataatctaaaaaataacgttttagcaacaggatttcttggt
gatgaaaactttgaaaaatttaataagaaatttaaagaattaaaattaaaaaataatttt
tttctatatccgggtaacactagaaccaattttaagattaaagatttatctaataattta
gaagtagagttaaatggatatggacaaaaaattgataaaaactatgttaataagttaatg
aattatttaaagaataatttaacaaaaaacgatatagttgttgtctctggtagcatacct
aaaaacctagattcaaaaatatatcaagaacttggtcaagtaatcaatcaaaagcaggcc
ttatttattttagatagttctaaaagcgctctattaaatggtttaaaatctaaaccctat
ttaattaaacctaatattggtgaattgtgtgctatatttgaaaaacaagttaaagactat
gattttatagagattcagaaaatgattttaaaactacgtcgccttggagctagaaatatc
ttattaagtatgggttctaatggaagctattttttctcagaagataactcgatttacaag
ataggtataggtaaaggtaaactgattaattctgttggagcaggagattctatgctagct
ggttttgttcatggaattgagaataatttatctctaattgaaactctaaaatacgcatca
gcgtgtggttcagcaacggcttttaacaaatgattagcgacaagcaaagacataaaaaaa
caaattatagagatcgaaatttggaaaatagaagaaggattatgcaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system