KEGG   Mycoplasma putrefaciens KS1: MPUT_0212Help
Entry
MPUT_0212         CDS       T01599                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mpf  Mycoplasma putrefaciens KS1
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mpf00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
219497..220396
Genome map
AA seq 299 aa AA seqDB search
MSHKKGKIIIISGPSGVGKGSVNSELLKNKYLKLKYSVSMTTRAPRPNEVDGVNYHFVSN
DQFAKAIVNDELIEYAHFVGNSYGTPRRYVEQELEKGYNVILEIEVDGATQVLNKEPNTL
SFFLMPPTLNELANRIRGRQTESEEKIKARLDKALIEVPLKHNYDYVIENDNVANAVAKI
TDVLHLEGLTDLNGPTVYERLEKIVEEIIKEHYMYFVNNWETNVKLLARNETEKTQAKNF
DAEKHLINLLTKKVYHKVLGHGDFLQLLDKDFVYFKIQKLMFKINFFSIEQKKHLDDER
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataaaaaaggaaaaataattattatttcaggaccaagtggtgttggcaaagga
tcagttaattcagaattattaaaaaataagtacttaaaattgaaatactcagtttcaatg
acaacccgagctccaagaccaaatgaagttgatggagttaattatcattttgtttcaaat
gatcaatttgccaaagctattgttaatgatgaattaattgaatatgctcattttgttggt
aattcttatggaactcctagaagatatgtcgaacaagaactagaaaaaggttacaacgta
attttagaaattgaagttgatggtgcaacgcaagttttaaataaagaaccaaacacacta
tcattttttttaatgcctccaactttaaatgaactagctaacagaattagaggtcgccaa
actgaaagtgaagaaaaaattaaagcaaggcttgataaagctttgattgaagtaccatta
aaacataattatgattatgtgattgaaaatgacaatgttgctaatgcagttgctaaaatt
actgatgttttacacttagaaggactaactgatcttaatggtccaacagtttatgaaaga
cttgaaaaaattgttgaagaaattattaaagaacattatatgtattttgttaataattga
gaaacaaatgttaagttactagcaagaaatgaaacagaaaaaactcaagccaaaaacttt
gatgctgaaaaacatttaattaatcttttaactaaaaaggtttatcataaggttttaggt
catggagattttttacaattattagataaagattttgtttattttaaaattcaaaaacta
atgtttaaaattaatttctttagtattgaacaaaaaaaacatcttgatgatgaacgctag

DBGET integrated database retrieval system