KEGG   Mycoplasma putrefaciens KS1: MPUT_0212Help
Entry
MPUT_0212         CDS       T01599                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mpf  Mycoplasma putrefaciens KS1
Pathway
mpf00230  Purine metabolism
mpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MPUT_0212 (gmk)
Enzymes [BR:mpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MPUT_0212 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Rad17 OmpH AAA_33 AAA_16 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEM68604
Position
219497..220396
Genome map
AA seq 299 aa AA seqDB search
MSHKKGKIIIISGPSGVGKGSVNSELLKNKYLKLKYSVSMTTRAPRPNEVDGVNYHFVSN
DQFAKAIVNDELIEYAHFVGNSYGTPRRYVEQELEKGYNVILEIEVDGATQVLNKEPNTL
SFFLMPPTLNELANRIRGRQTESEEKIKARLDKALIEVPLKHNYDYVIENDNVANAVAKI
TDVLHLEGLTDLNGPTVYERLEKIVEEIIKEHYMYFVNNWETNVKLLARNETEKTQAKNF
DAEKHLINLLTKKVYHKVLGHGDFLQLLDKDFVYFKIQKLMFKINFFSIEQKKHLDDER
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataaaaaaggaaaaataattattatttcaggaccaagtggtgttggcaaagga
tcagttaattcagaattattaaaaaataagtacttaaaattgaaatactcagtttcaatg
acaacccgagctccaagaccaaatgaagttgatggagttaattatcattttgtttcaaat
gatcaatttgccaaagctattgttaatgatgaattaattgaatatgctcattttgttggt
aattcttatggaactcctagaagatatgtcgaacaagaactagaaaaaggttacaacgta
attttagaaattgaagttgatggtgcaacgcaagttttaaataaagaaccaaacacacta
tcattttttttaatgcctccaactttaaatgaactagctaacagaattagaggtcgccaa
actgaaagtgaagaaaaaattaaagcaaggcttgataaagctttgattgaagtaccatta
aaacataattatgattatgtgattgaaaatgacaatgttgctaatgcagttgctaaaatt
actgatgttttacacttagaaggactaactgatcttaatggtccaacagtttatgaaaga
cttgaaaaaattgttgaagaaattattaaagaacattatatgtattttgttaataattga
gaaacaaatgttaagttactagcaagaaatgaaacagaaaaaactcaagccaaaaacttt
gatgctgaaaaacatttaattaatcttttaactaaaaaggtttatcataaggttttaggt
catggagattttttacaattattagataaagattttgtttattttaaaattcaaaaacta
atgtttaaaattaatttctttagtattgaacaaaaaaaacatcttgatgatgaacgctag

DBGET integrated database retrieval system