KEGG   Mycoplasma putrefaciens KS1: MPUT_0457Help
Entry
MPUT_0457         CDS       T01599                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpf  Mycoplasma putrefaciens KS1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MPUT_0457 (ruvA)
Enzymes [BR:mpf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MPUT_0457 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(516410..516964)
Genome map
AA seq 184 aa AA seqDB search
MKEYIIAKLEKIDQNYLYLLKDDVCYKFYYSKNDAKQLKLNDQLKLYISTIWIENEIKDF
AFVNQDNRDLFEILIKINTIGQKTVLKILDNYSYQELIEIFRIGDIDKILKIKGIGAYTA
KLIINAIQKALFNNQLSEKKQKVLISLEKLGYKTKDIYKVIINADNKLNTDQLTKYVLLN
INNV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatacataatagctaaactagaaaaaattgatcagaattatttatatttatta
aaagatgatgtttgttataaattttattattctaaaaatgatgcaaagcaattaaagtta
aacgaccaacttaagttgtatatttcaactatctgaatcgaaaatgaaattaaggacttt
gcttttgtaaatcaagataatcgtgatctgtttgagattttgataaaaattaatacaata
ggtcaaaaaacagttttaaagattttagataattatagttatcaagagttaattgaaatt
tttagaataggtgatattgataagattttaaaaattaaagggattggagcatacactgca
aaactaattattaatgcaattcaaaaagcactatttaataatcagttaagtgagaaaaaa
caaaaagtcttaattagtttagaaaaattaggatataaaactaaagatatttacaaagtt
attattaatgctgataataaattaaacactgaccaattaactaaatatgttcttttaaat
attaacaatgtttag

DBGET integrated database retrieval system