KEGG   Mycoplasma putrefaciens KS1: MPUT_0517Help
Entry
MPUT_0517         CDS       T01599                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mpf  Mycoplasma putrefaciens KS1
Pathway
mpf00010  Glycolysis / Gluconeogenesis
mpf00625  Chloroalkane and chloroalkene degradation
mpf00626  Naphthalene degradation
mpf01100  Metabolic pathways
mpf01110  Biosynthesis of secondary metabolites
mpf01120  Microbial metabolism in diverse environments
mpf01130  Biosynthesis of antibiotics
mpf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPUT_0517 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    MPUT_0517 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MPUT_0517 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MPUT_0517 (adh)
   00626 Naphthalene degradation
    MPUT_0517 (adh)
Enzymes [BR:mpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MPUT_0517 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N NAD_binding_2 UDPG_MGDP_dh_N CMAS Methyltransf_25 ZoocinA_TRD 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AEM68875
Position
complement(573522..574565)
Genome map
AA seq 347 aa AA seqDB search
MAKMKAFVVRESRKWSVELVDIPEPKEKEVLIKMETSGICHTDLHAANYDWLVEPKYPLI
PGHEGIGIVAKLGPGCTHLKVGDRVCLAWLHDTCGHCEYCLTGRETLCPDQNMSAYTKDG
SFAEYAIGHEDFVGLVPKQLDVITGAPVVCAGVTTYKAVKQAKLKPGNFIVVIGVGGLGQ
MAIQYAKAMGYRVIGIDIADEKVDLALKSGAEFAFNSKKVNAIEKVIEVTNGGAHGVINT
SVASSVTSQGMEMLRRGGRQVLVGLPAKDKLGKDEFAVSIFWTVLLERELAGSIVGTRKD
LQEALDYATRGLVKSEVTKIVKLDQVAEIFEKLEKGDFIGRAVIDFR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatgaaagcttttgtggttcgtgaatcacgtaaatgaagtgtagaattagta
gatattcctgaaccaaaggaaaaagaagttttaattaaaatggaaactagcggaatttgt
catacagatttacatgcagcaaattatgactgattagtagaaccgaaatatcctttgatt
cctggtcatgaaggtattggtattgttgcaaaactaggaccaggatgtacacatctaaaa
gttggtgatcgagtttgtttagcctgattacatgacacatgcggacattgtgaatattgt
ttaactggtagagaaacattatgtcctgatcaaaatatgtcagcttatacaaaagatggg
tcatttgctgaatatgcaattggacatgaggattttgttggtttagttccaaagcaatta
gatgtcataactggtgctccggttgtttgtgctggtgtaactacttataaagctgtcaaa
caagctaaattaaaacctggaaatttcatagttgttattggagttggtggattgggtcaa
atggctattcaatatgcaaaagctatgggttatagagttattggtattgatatagcagat
gaaaaagttgatttagctttaaaatcaggagcagagtttgcttttaatagtaaaaaagtt
aatgctattgaaaaagttattgaagttacaaatggtggagctcatggtgtaattaacaca
tcagttgcatcatcagtaactagtcaaggtatggaaatgcttagacgtggtggacgtcaa
gtattagtaggtttacctgctaaagataaattaggaaaagatgagtttgctgtttctata
ttttgaactgtactattagagcgtgaattagccggatcaattgtaggtactcgcaaagat
ttacaagaagcactagattatgctactagaggtttagttaaatctgaagtaactaaaata
gttaaattagatcaagttgccgaaatatttgaaaagcttgaaaaaggtgattttataggt
agagcagttattgattttagataa

DBGET integrated database retrieval system